Next Article in Journal
Immunization Catch-Up for Newly Arrived Migrants in France: A Cross-Sectional Study among French General Practitioners
Next Article in Special Issue
Epitope–Paratope Interaction of a Neutralizing Human Anti-Hepatitis B Virus PreS1 Antibody That Recognizes the Receptor-Binding Motif
Previous Article in Journal
Overwhelming Evidence for a Major Role for Herpes Simplex Virus Type 1 (HSV1) in Alzheimer’s Disease (AD); Underwhelming Evidence against
Previous Article in Special Issue
The Relevance of Monoclonal Antibodies in the Treatment of COVID-19
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Therapeutic Potential of HLA-I Polyreactive mAbs Mimicking the HLA-I Polyreactivity and Immunoregulatory Functions of IVIg

by
Mepur H. Ravindranath
1,2,*,
Fatiha El Hilali
3 and
Edward J. Filippone
4
1
Department of Hematology and Oncology, Children’s Hospital, Los Angeles, CA 90027, USA
2
Emeritus Research Scientist at Terasaki Foundation Laboratory, Santa Monica, CA 90064, USA
3
Mohamed V. Hospital, Mekines 50060, Morocco
4
Division of Nephrology, Department of Medicine, Sidney Kimmel Medical College at Thomas Jefferson Univsity, Philadelphia, PA 19145, USA
*
Author to whom correspondence should be addressed.
Vaccines 2021, 9(6), 680; https://doi.org/10.3390/vaccines9060680
Submission received: 28 April 2021 / Revised: 3 June 2021 / Accepted: 5 June 2021 / Published: 21 June 2021
(This article belongs to the Collection Research on Monoclonal Antibodies and Antibody Engineering)

Abstract

:
HLA class-I (HLA-I) polyreactive monoclonal antibodies (mAbs) reacting to all HLA-I alleles were developed by immunizing mice with HLA-E monomeric, α-heavy chain (αHC) open conformers (OCs). Two mAbs (TFL-006 and TFL-007) were bound to the αHC’s coated on a solid matrix. The binding was inhibited by the peptide 117AYDGKDY123, present in all alleles of the six HLA-I isoforms but masked by β2-microglobulin (β2-m) in intact HLA-I trimers (closed conformers, CCs). IVIg preparations administered to lower anti-HLA Abs in pre-and post-transplant patients have also shown HLA-I polyreactivity. We hypothesized that the mAbs that mimic IVIg HLA-I polyreactivity might also possess the immunomodulatory capabilities of IVIg. We tested the relative binding affinities of the mAbs and IVIg for both OCs and CCs and compared their effects on (a) the phytohemagglutinin (PHA)-activation T-cells; (b) the production of anti-HLA-II antibody (Ab) by B-memory cells and anti-HLA-I Ab by immortalized B-cells; and (c) the upregulation of CD4+, CD25+, and Fox P3+ T-regs. The mAbs bound only to OC, whereas IVIg bound to both CC and OC. The mAbs suppressed blastogenesis and proliferation of PHA-activated T-cells and anti-HLA Ab production by B-cells and expanded T-regs better than IVIg. We conclude that a humanized version of the TFL-mAbs could be an ideal, therapeutic IVIg-mimetic.

1. Introduction

Personalized, passive immunotherapy encompasses the transfer of monoclonal antibodies (mAbs), polyclonal antibodies (Abs), and purified natural Abs for the specific purpose of either upregulating or suppressing immune functions, depending on the nature and status of the underlying disease. A variety of mAbs, capable of performing specific functions, are available. These include antibodies capable of depleting various cell types such as B-cells (rituximab), CD52-bearing leukocytes (alemtuzumab), and CD33-bearing cells (gemtuzumab). Additionally, mAbs can inhibit various cytokine pathways such as the TNF–TNFR axis (etanercept, adalimumab, infliximab) and the IL-6-IL-6R axis (tocilizumab, actemra). In contrast, therapeutic intravenous immunoglobulin (IVIg) contains purified natural Abs, prepared by pooling and purifying IgG from the plasma of 10 to 60 thousand normal and healthy donors. The United States Food and Drug Administration (FDA) has approved immunoprophylaxis with IVIg therapy for chronic inflammatory demyelinating polyneuropathy (CIDP), immune thrombocytopenic purpura (ITP), primary immunodeficiency (PI), secondary immunodeficiency in chronic lymphocytic leukemia, pediatric human immunodeficiency virus (HIV) infection, Kawasaki disease, prevention of graft vs. host disease in adult bone marrow transplant recipients, and organ transplantation [1].
The presence of pre-existing Abs in a potential organ transplant recipient is referred to as sensitization. It remains one of the significant immunological barriers to receiving an organ. As well as restricting the availability of a given organ for a particular patient, these antibodies cause long-term graft attrition when present post-transplantation [2,3]. IVIg is administered to end-stage organ disease patients pre-transplantation and allograft recipients post-transplantation for reduction (desensitization) of these HLA Abs. The exact mechanism of desensitization by IVIg has not been elucidated. However, IVIg per se contains polyreactive, natural IgGs against multiple targets, including endogenous and exogenous Abs, immunomodulating peptides, blood group antigens, and various cytokines. Whereas some of the immunoregulatory mechanisms of the action of IVIg have been proven in vitro and animal models, many proposed mechanisms remain enigmatic due to IVIg polyantigen reactivity, polyclonality, and diversity in the preparations of IVIg. Several mechanisms of action of IVIg have been proposed [4]. These include (a) Fc-receptor blockade, (b) neutralization of Abs by idiotypic and anti-idiotypic Abs, (c) blockade of the Fas apoptotic pathway by anti-Fas auto-Abs, (d) regulation of complement components, (e) modulation of cytokine secretion, (f) hindrance of natural-killer cell activity, (g) inhibition of matrix metalloproteinase-9, (h) suppression of NF-kB activation and IkB degradation, (i) G1 cell cycle arrest, (j) prevention of tumor growth, (k) decrease in leukocyte recruitment, (l) attenuation of T-cell stimulation, (m) effects on Ab kinetics, and (n) effects on dendritic cells. These mechanisms of IVIg are not mutually exclusive and operate synergistically.
Additionally, more observations have accrued to document that normal, healthy human sera contain a diverse variety of IgG Abs against allo-HLA molecules [5,6,7,8,9]. Therefore, the IVIg purified from the pooled plasma of thousands of healthy individuals clearly carries allo-HLA Abs.
Our research commenced with studying the structure of a non-classical HLA class-I (HLA-I) antigen, namely HLA-E and anti-HLA-E mAbs [10,11]. Anti-HLA antibodies do not react with an entire antigen; like all antibodies, the reaction is against a portion of the antigen termed an epitope. At the center of the epitope is an eplet consisting of one to several amino acids recognized by the complementarity-determining regions of the antibody. Epitopes may be specific to a single HLA locus or HLA allele (private epitopes, vide infra). Other times, the epitope may be shared by other loci or alleles (public epitopes, vide infra). The unique and shared amino acid sequences of the diverse HLA-I antigens were identified to elucidate whether the mAbs generated by immunizing an HLA-I antigen recognized public or private epitopes. In addition, the relative immunoregulatory capability of antibodies against either public or private epitopes deserves consideration. The objective of this review is to compare the nature and functional characteristics of the polyreactive anti-HLA-E mAbs (TFL-006 and TFL-007) with those of the commercial preparations of therapeutic IVIg as follows:
  • Determine if HLA-E shares antigenic amino acid sequences (epitopes) common to all other HLA-I isoforms;
  • Document HLA-I polyreactivity of HLA-E mAbs;
  • Document HLA-I polyreactivity of the therapeutic preparations of IVIg;
  • Compare immunomodulation by IVIg with polyreactive mAbs
    Suppression of T-cell proliferation;
    Suppression of antibody production by B cells;
    Expansion of Foxp3+ Tregs.

2. HLA-E Shares Antigenic Amino Acid Sequences (Epitopes) Common to All Other HLA-I Isoforms

HLA antigens, located on the surface of all nucleated cells of the human body, are of two different major classes, HLA-I and HLA class-II (HLA-II). The genes that encode HLA-I and HLA-II are closely associated with each other on the short arm of human chromosome 6. The entire complex of HLA encompasses four million base pairs of DNA and “is of a size comparable to the genome of Escherichia coli” [12].
The HLA-I molecule is a heterodimer with a 45 kDa α-heavy chain (αHC) anchored to the bilayer lipid membrane. It is complexed with a water-soluble, 12 kDa light chain called β2microglobulin (β2m) (Figure 1), encoded by a gene located on chromosome 15. The HLA-I loci consist of the classical HLA-Ia and non-classical HLA-Ib loci, each containing three loci: HLA-Ia (HLA-A, HLA-B, and HLA-C) and HLA-Ib (HLA-E, HLA-F, and HLA-G). The α C of HLA-I consists of different domains encoded by different exons. The leader peptide is encoded by exon 1, and the three extracellular domains (α1, α2, and α3) are encoded by exons 2, 3, and 4 respectively. The transmembrane domain is encoded by exon 5, and the cytoplasmic tail by exons 6 and 7. The antigenic polymorphism of different isoforms is reflected in the amino acid sequences. As noted above, the sequences or epitopes characteristic of each allele of each locus are referred to as its “private epitopes” or “specific sequences.” However, all isoforms also share several common or shared sequences with other alleles of the same locus or other loci, referred to as “public epitopes”.

2.1. Private and Public Epitopes of HLA-E

Table 1 shows both HLA-E amino acid sequences that are specific and those that are shared with alleles of other loci of HLA-I. Some amino acid sequences or epitopes are specific to the HLA-E locus because they are not found in other HLA-Ia or Ib loci. The most striking private epitopes or sequences are 65RSARDTA70 and 143SEGKSNDASE152. Table 2 summarizes the results of comparing HLA-E sequences with hundreds of alleles from the HLA-Ia and HLA-Ib loci. Some sequences of HLA-E are found in only one allele. The HLA-E sequences, or PRAPWMEQE, and EPPKTHVT are found in HLA-A*3306 and HLA-B*8201, respectively, whereas HLA-E sequences 117AYDGKDY123 and 126LNEDLRSWTA135 are shared with all other HLA loci (HLA-A, HLA-B, HLA-C, HLA-F, and HLA-G) that we have examined. These latter sequences perfectly befit the definition of “shared” or “public epitopes.”

2.2. The Most Widely Shared Public Epitopes Are Cryptic in HLA-I

The HLA-I molecule is a heterodimer because the α-HC is closely associated with β2m (Figure 1). As a consequence, not all sequences of HLA α-HC are exposed. Figure 1A shows that the specific sequences, or the private epitopes, of HLA-E (shown in yellow), 65RSARDTA70 and 143SEGKSNDASE152, are exposed for direct binding of Abs. Figure 1B shows that the most commonly shared sequences or the public epitopes (shown in yellow) 117AYDGKDY123 and 126LNEDLRSWTA135 are cryptic, as they lie in close proximity with β2m. Figure 2 illustrates the crypticity of the shared epitope, 117AYDGKDY123. The exposure of these shared epitopes depends on the nature of the HLA molecule. Most often, the HLA molecules occur as heterodimers, also designated as “closed conformers” or CCs. In CCs, the most prevalent shared epitopes, 117AYDGKDY123 and 126LNEDLRSWTA135, are masked by β2m. However, in β2m-free α-HCs, designated as “open conformers” (OCs), they are exposed.
Thus, the HLA-I molecules occur as heterodimers complexed with β2m on the cell surface and as β2m-free α-HC OCs. Schnabl et al. [13] reported that T lymphocytes activated in vitro or in vivo, but not resting, expressed many OCs. Using the mAb W6/32 that specifically recognized HLA-I CCs and the mAbs L45 and HC10 that bound explicitly to OCs but not to CCs, they confirmed the existence of HLA-OCs. Immunoprecipitation and co-capping experiments showed that LA45 was bound to HLA-I OCs at the cell surface. The mAb L45 bound to PHA-activated T-cells from a panel of 12 people with different HLA types, suggesting that LA45 might bind to epitopes shared by all HLA-I α-HCs. The HLA-I OCs expressed on the cell surface of activated T-cells—or EBV-transformed B-cells—are referred to as “peptide-binding empty HLA” [14,15]. The presence of HLA-I OCs was confirmed on activated T-cells in vitro and in vivo and on B cell lines (RAJI, NALM6), EBV-transformed B-cells, and the myeloid cell line KG-1A [16,17]. Interestingly, the expression of OCs on the cell surface in normal human T-cells upon activation and cell division correlated with the level of proliferation [18]. Indeed, the OCs on the cell surface were glycosylated. The inhibition of tyrosine phosphorylation with the Src-family tyrosine kinase inhibitor PP2 resulted in the enhanced release of HLA-I α-HC from the cell surface of activated T-cells. Further studies indicated that the OCs were regulators of ligand–receptor interactions and had potential implications for immune activation [18,19,20] and immune regulation [21]. The inflamed tissues in spondyloarthropathy showed increased levels of OCs on CD14b+ monocytes compared to other leukocyte subsets. The level of OCs also increased on activated dendritic cells of the extravillous trophoblast [22]. Interestingly, the OCs maintained the peptide-binding groove in vitro [23]. Khare et al. [24] reported that the β2m-free HCs of HLA-B27 might induce arthritis in transgenic mice, and β2m-free, HC-specific Abs decreased the disease incidence in this model. OCs exist as dimers or in clusters at the cell surface in vivo [23,25,26], profoundly impacting receptor engagement. Recognition of OCs as ligands by members of the killer Ig receptor family (KIR) and Ig-like transcript (ILT)/LIR/LILR family could influence their immunomodulatory function in inflammatory disease [27]. The shared sequences presented in HLA-E OCs contribute to the generation of HLA-I polyreactivity Abs.
Though the OCs are found on activated immune cells, the soluble forms of HLA-I present in humans also occur as OCs. Demaria et al. [28] found that the levels of OCs in circulation were regulated by proteolytic cleavage. The release was mediated by a Zn(2+)-dependent, membrane-bound metalloprotease (MMP). Specific separation by the metalloprotease occurs at a site close to the papain cleavage site in the α3 domain of HLA-I HCs. This site is not accessible to MMP in CCs. During the shedding of HLA-I trimers under different pathological conditions, the exogenous peptide and β2m dissociate from these CCs, and subsequent cleavage of OCs (Figure 3) may be partially responsible for controlling the levels of OC on the surface of activated cells. Since the shed OCs expose previously cryptic epitopes, they may be recognized by B-cells for antibody production.

2.3. Antigenicity Rank of the Most Widely Shared Public Epitopes of HLA-E

An Ab directed against a protein antigen can recognize either a linear or a discontinuous sequence (still closely aligned in space due to protein folding) in its native conformation. This so-called eplet is present at the center of an epitope. The immunogenicity of an epitope is defined as its ability to actively induce an immune response. In contrast, the antigenicity of an epitope is defined as its passive ability to be recognized by the immune system. The antigenicity of a sequence, or epitope, in a polypeptide can be predicted using parameters such as hydrophilicity, flexibility, accessibility, beta turns, cell surface exposure, and polarity. Several methods are known for predicting the antigenicity of a continuous sequence. Chou and Fasman [31] developed a methodology, based on α-turns in protein secondary structures, for predicting antigenicity. Kolaskar and Tongaokar [32] developed a semi-empirical method using the physicochemical properties of amino acid residues and their frequency of occurrence in segmental epitopes. Karplus and Scholtz [33] predicted antigenicity based on three flexibility scales. Parker et al. [34] predicted antigenicity with a novel hydrophilicity scale. In these methods, when computing the score for given residue i, the amino acids in an interval of the chosen length, centered around residue i, are considered.
Further details are provided on the antibody epitope prediction web (http://tools.immuneepitope.org/tools/bcell/iedb_input (Last updated on 30 May 2021, see also iedb.org for details). The methods were collectively employed to assess the antigenicity ranking of the different sequences of HLA-E listed in Table 2. Among the shared peptide sequences listed in the table, the most prevalent shared epitope, 117AYDGKDY123, ranked first in antigenicity. We have used these peptide sequences and the second-ranking epitope for peptide inhibition studies of anti-HLA-E mAbs and established that mAbs TFL-006 and TFL-007 are the most polyreactive [10,11,35,36].

3. Documentation of HLA-I Polyreactivity of HLA-E mAbs

3.1. Methodology–Development and Characterization of HLA-E mAbs

3.1.1. Anti-HLA-E mAb Production

The mAbs were produced following the recommendations of the National Research Council’s Committee on Methods of Producing mAbs [37]. The recombinant α-HCs HLA-ER107 and HLA-EG107 (source: Immune Monitoring Laboratory, Fred Hutchinson Cancer Research Center, concentration: 10 mg/mL in MES buffer) were used. Two mice were immunized with 50 mg of each antigen in PBS (pH 7.4, 100 mL) admixed with TiterMax (100 mL) (Sigma-Aldrich, St Louis, MO, USA) adjuvant before injection into the footpad and intraperitoneally. Three immunizations were given at about 12-day intervals, with an additional immunization after 12 days for mice receiving HLA-EG107.
The clones were cultured in a medium (RPMI 1640 w/L-glutamine and sodium bicarbonate, with 15% FBS, penicillin, streptomycin, L-glutamine, and sodium pyruvate. Hybridomas were cryopreserved in RPMI containing 10% DMSO and 20% FBS. All culture supernatants were screened for IgG reacting to HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, and HLA-G using single-antigen microbeads on a Luminex platform. The mean fluorescent intensity (MFI) was determined for supernatants after diluting to 1/2. The MFI values were corrected against those obtained with negative control beads. Further details are provided elsewhere [35,38].

3.1.2. HLA-1 Antigen-Coated Single Antigen Beads (SABs) and the Luminex Platform for Monitoring the Reactivity and the Density of These mAbs

The affinity of Abs to different HLA-I antigens was monitored on a Luminex Platform, using HLA-I molecules, coated as single antigens, on the multiplex, fluorescinated microbeads. Three different kinds of microbeads were available for investigation, as illustrated in Figure 4: (i) beads with an admixture of CCs and OCs (Regular LABScreen SAB, source: One Lambda, Inc., Canoga Park, CA, USA), (ii) beads restricted to CCs only (iBeads developed by trypsinization of regular LABScreen beads and Immucore LIFECODES SAB), and (iii) beads restricted to OCs (alkali or acid-denatured beads). The regular LABScreen microbeads were coated with HLA-A (31 different antigens), HLA-B (50 different antigens), and HLA-C (16 different antigens). In addition, the HLA-Ia microbeads had built-in control beads: positive beads coated with human IgG and negative beads coated with serum albumin (human or bovine). For HLA-Ib, the control beads (both positive and negative) were added separately.
The different kinds of microbeads were characterized using three different mAbs (Figure 4). The mAb W6/32 (IgG2a) bound to CCs, but not to OCs [39], and bound to both peptide-associated and peptide-free CCs [40,41]. The mAb HC-10 (IgG2a) recognized an epitope in HLA-I between amino acid positions 57 and 62, with arginine at position 62 (R62) being crucial for HC-10 binding [42]. HC-10 recognized cell surface CCs devoid of a peptide, whereas the presence of a peptide reduced HC-10 reactivity [43]. The mAb TFL-006 (IgG2a) bound to OCs of all HLA-I loci and was inhibited by peptides from the amino acid sequences shared by all HLA-I loci [35,36].

3.2. The HLA Reactivity Groups of mAbs Generated by Recombinant HLA-E OCs

More than 200 hybridomas were generated using the OCs of HLA-E. All mice experiments were carried out under the guidance of Professor Paul I. Terasaki, who owned One Lambda, Inc., in Canoga Park, CA, USA, with animal subject committee approval. The mAbs secreted by these hybridomas were both HLA-E monospecific and HLA-Ia and HLA-Ib polyreactive. These mAbs could be categorized into eight different groups, as shown in Table 3. Group 1 corresponds to monospecific mAbs reacting restrictively with HLA-E. Group 4 refers to HLA-Ib-specific mAbs. Group 10 represents mAbs, recognizing both HLA-Ia and HLA-Ib molecules (Table 4).
Table 4 compares the HLA-I reactivities of an HLA-E monospecific mAb, TFL-033, with two HLA-I polyreactive mAbs, namely TFL-006 and TFL-007. TFL-006 showed reactivity with 32 alleles of HLA-A, 48 alleles of HLA-B, and 16 alleles of HLA-C, whereas TFL-007 reacted with 24 HLA-A, 44 HLA-B, and 16 HLA-C alleles. TFL-006 did not react with B*4901 and B*5701, although shared sequences (public epitopes) were present. TFL-006 and TFL-007 reacted with all three HLA-Ib isoforms as follows: HLA-E (+++) > HLA-G (++) > HLA-F (+). Among HLA-Ia isoforms, the reactivities in general were as follows: HLA-C (+++) > HLA-B (++) > HLA-A (+). The MFIs of the mAbs against A*1101 were the highest among HLA-A isoforms, with B*4006 the highest among HLA-B isoforms and C*1802 the highest among HLA-C isoforms. Of the seven HLA polyreactive mAbs belonging to group 10, TFL-006 ranked first, and TFL-007 ranked second. The reactivities of other mAbs of group 10 are presented elsewhere [44].
To determine the affinity of the mAbs TFL-006 and TFL-007 for shared sequences in the OCs, synthetic peptides purified by reverse-phase HPLC from GenScript Corporation (Piscataway, NJ, USA) were obtained [10]. Table 2 compares peptide inhibition using three commonly shared peptides, namely DTAAQI, AYDGKDY, and LNEDLRSWTA. These peptides were used, separately, to block the binding of the mAbs to the regular LABSCreen SABs, in which the OCs (β2m-free α-HC) were admixed with intact HLA trimers (CCs). Of the three peptides tested, AYDGKDY blocked more than 52% of the binding to the mAb TFL-006 compared to the other two peptides. Similar results were obtained with mAb TFL-007.
To further ascertain that the mAbs recognized only the OCs, we compared the binding of mAb TFL-006 on LABScreen SABs (One Lambda, Inc., Canoga Park, CA, USA), which contained an admixture of OCs and CCs and with LIFECODES SABs (LSA Class I 03203F beads; Immucor, Norcross, GA, USA) that was devoid of HLA-I OCs [45,46,47,48]. The results presented in Table 5 show that the mAb TFL-006 did not bind to any of the alleles of the isoforms of HLA-I on LIFECODES SABs, confirming that mAb TFL-006 recognized only the OCs and did not bind to CCs on the LIFECODES beads. Earlier, we have shown that mAb TFL-006 binds well on acid-denatured LABScreen beads but not on iBeads, in which β2m-free HCs (OCs) are selectively, enzymatically removed from the regular LABScreen beads [45,46].

4. Documentation of HLA-I Reactivity of the Therapeutic Preparations of IVIg

The FDA, in 2004, approved the Cedars–Sinai IVIg desensitization protocol for minimizing allo-HLA Abs in patients waiting for kidney transplantation, given the known ability of HLA antibodies to destroy an allograft. Removal, or significant reduction, of such Abs, would then allow transplantations to proceed that would have otherwise been contraindicated. Since then, IVIg has emerged as a potential treatment strategy for desensitization protocols, pre-transplantation, and is now used post-transplantation for treating Ab-mediated rejection (AMR) caused by donor-specific anti-HLA Abs (DSA). Several clinical transplant centers adopted this strategy [2,3,49,50,51,52,53]. However, subsequent studies documented that IVIg preparations were often unable to reduce HLA Abs in the sera of transplant patients [54,55,56]. We examined five different therapeutic preparations of IVIg, namely GamaSTAN S/D (Talecris Biotherapeutics, Inc., Research Triangle Park, NC, USA), Sandoglobulin (6 gr, lot 4305800026; CSL Behring, Kankakee, IL, USA), Octagam (6 gr, lot A913A8431; Octapharma Pharmazeutika, Lachen, Switzerland); IVIGlob EX (VHB Life Sciences Limited, Bangalore, India) [34,35], and Immunoglobulin Normale (IV-LFB-CNTs LFB Biomedicaments, Courtaboeuf Cedex, France)[57].
HLA-I reactivities of the different dilutions (1/2 to 1/128) of IVIg preparations were tested on regular LABScreen SABs, acid-denatured LABScreen SABs (OCs only), and on enzymatically treated regular LABScreen SABs, called iBeads (CCs only). The details of this methodology are presented elsewhere [34]. Figure 5 compares the MFIs, signifying the density of HLA-Ia and HLA-Ib IgG Abs on the three different SABs for IVIg preparations from GamaSTAN (Figure 5A) and octagam (Figure 5B). Table 6 summarizes the HLA-I polyreactivity of commercial preparations of IVIg from different sources. The data presented in Figure 5A,B reveal that the strength of the Abs is much higher in denatured SABs, which is predominant with OCs, than in the CCs restricted to the iBeads. These findings confirmed that the anti-HLA IgG Abs in the IVIg preparations recognized both the CCs and OCs of HLA molecules, but with a higher prevalence of Abs recognizing OCs. To ascertain whether the immunoreactivity of IVIg to HLA-Ia alleles was due to the OCs of HLA-I, the anti-HLA-1a Abs were adsorbed out with Sephadex gel conjugated with OCs of HLA-E and then tested for HLA-E and HLA-Ia reactivity [35]. IVIg immunoreactivity to HLA-Ia was minimized after the adsorbing-out process. Most importantly, HLA-E OCs alone could absorb out a major fraction of anti-HLA-1a antibodies, indicating the prevalence of polyreactive antibodies against HLA-I OCs in IVIg preparations. This unique finding formed the basis for comparing the functional characteristics of IVIg with HLA-I polyreactive mAbs (TFL-006 and TFL-007).

5. Immunomodulation By IVIg Compared with Polyreactive Monoclonal Antibodies

5.1. Suppression of T-Cell Proliferation: IVIg vs. HLA-I-Polyreactive mAbs

5.1.1. Background and Hypothesis

Activation of T-cells involves both blastogenesis and proliferation. Activation can be accomplished by natural or recombinant cytokines and PHA (phytohemagglutinin). Activation induces transitory expression of several molecules, both within the T-cell or on the cell surface. They include the IL-2 receptor, Fc receptors for IgG, insulin receptors, α fetoprotein, and transferrin receptors, MICA, HLA-II, and OCs of HLA-I [58]. Several studies documented that commercial IVIg inhibited PHA- or cytokine-induced T-cell activation and proliferation, both in vitro and in vivo [59,60,61,62,63,64,65,66,67,68,69,70,71,72,73].
Kaveri et al. [59] demonstrated that Abs to a conserved region of HLA-Ia, present in pooled therapeutic IVIg, were capable of modulating CD8+ T-cell-mediated function. Klaessn et al. [60] showed that IgG and F(ab)2 fractions in IVIg were responsible for the inhibitory function. In contrast, Miyagi et al. [61] attributed the inhibition of blastogenesis and proliferation of activated T-cells by IVIg to the Fc receptors for IgG, FcγRI (CD23), FcγRII (CD32), FcγRIII (CD16), and FcγRIV (CD64), expressed on the immune cells upon activation. MacMillan et al. [70] documented further the IVIg-mediated suppression of T-cell proliferation, with or without CD28 co-stimulation. Sali et al. [62] demonstrated that 2% intact or Fab2 fragments of IVIg could penetrate immune cells to modulate these activities. The penetrating fraction of IVIg inhibited the upregulation of activation marker CD25 on CD4+ splenocytes. In a placebo-controlled trial, the administration of IVIg to patients with inflammatory myopathies was associated with a significant reduction of the number of T-lymphocytes in vivo [74].
Based on these observations, it was hypothesized that HLA-I polyreactive mAbs that mimicked HLA-I reactivity of IVIg preparations might suppress activated T-cells, similarly to IVIg. The hypothesis was tested by comparing dose-dependent effects on the suppression of PHA-activated T-cells of three entities: IVIg, HLA-I polyreactive mAbs that mimicked IVIg (TFL-006 and TFL-007), and mAbs that did not mimic IVIg (TFL-033 and TFL-037).

5.1.2. Hypothesis Testing: Measurement of T-Lymphocyte Proliferation

More details are presented elsewhere, but all experimental analyses were carried out at Terasaki Foundation Laboratory with Review Board approval [58]. Briefly, we labeled purified human T-lymphocytes (freshly collected from a healthy, young adult male) with the intracellular fluorescent dye Carboxyfluorescein N-succinimidyl ester (CFSE), a cell-permeable dye that remained in the cell for several mitotic divisions. The technology used is illustrated in Figure 6A. Most importantly, the cessation of the progress of mitotic activity could be monitored as successive two-fold reductions in the fluorescent intensity after 72 h of treatment, including the addition of PHA and PHA plus IVIg or mAbs [58].

5.1.3. The Suppression of Activated T-Cells by IVIg vs. mAbs

A summary of the findings is presented in Figure 6B, Figure 7 and Figure 8. The results established the differential effects on the suppression of PHA-activated T-cells, both by IVIg and by HLA-I polyreactive mAbs (TFL-006 and TFL-007). The mAbs (TFL-033 and TFL-037) that did not mimic the HLA-I reactivity of IVIg did not affect the activation or proliferation of T-cells. The mAbs TFL-006 and TFL-007 appeared to be more potent suppressors of the blastogenesis and proliferation of activated CD4+ T lymphocytes than IVIg. The concentrations of the mAbs required for the suppression of T-cell proliferation were 50-fold lower than the required concentration of IVIg. The suppression of blastogenesis and proliferation of T-cells by both IVIg and the anti-HLA-E mAbs was dose-dependent, and the dose required with mAbs was 50–150-fold lower than with IVIg. The mAb binding to OCs might have signaled T cell deactivation because the OCs have an elongated cytoplasmic tail with phosphorylation sites (tryosine320/serine335).
A tentative model of PHA-mediated activation and HLA polyreactive, mAb-mediated deactivation is proposed (Figure 9). It is known that PHA activation initiates phosphorylation of the cytoplasmic domain of CD3 and the activation of transcription factors. TCR cross-linking leads to the expression and phosphorylation of cell surface molecules such as IL-Rα [74] and the OCs of HLA-I [13,14,15,16,17,18,19,20,21,22]. The binding of mAbs to the shared amino acid sequences or epitopes exposed on the OCs may dephosphorylate the tyrosyl and seryl residues on the elongated cytoplasmic tails of the HLA-I OCs [75,76]. This may simultaneously lead to dephosphorylation of CD3 and revert the PHA-activation of CD3 on T-cells (for further details, see the legend for Figure 9). Upon dephosphorylation, T-cells were deactivated, resulting in the suppression of blastogenesis and proliferation. Based on the observations that there was a suppression of the blastogenesis and proliferation of PHA-activated CD4+ T-cells by HLA-I polyreactive, anti-HLA-E mAbs (TFL-006 and TFL-007) but not by HLA-I non-reactive, anti-HLA-E mAbs (TFL-033 and TFL-007), it was inferred that the IVIg-mediated suppression of the blastogenesis and proliferation of PHA-activated CD4+ T-cells could also be due to binding of the HLA-I OC-reactive IgG fraction in IVIg. Furthermore, when equal concentrations of the HLA-I polyreactive mAb TFL-007 and IVIg were compared, the suppression by the mAbs was greater than that of the IVIg. Evidently, the admixture of other IgGs with HLA-polyreactive IgGs in IVIg might have hindered the T-cell suppressive efficacy of the IVIg.

5.2. Suppression of Antibody Production by B-Cells: IVIg vs. HLA-I Polyreactive mAbs

5.2.1. Background and Hypothesis

Previous literature documented that commercial IVIg not only inhibited PHA- and cytokine-induced T-cell activation and proliferation and significantly reduced the number of T-lymphocytes in vivo in a placebo-controlled trial in patients with inflammatory myopathies, but it was also capable of suppressing antibody production in patients under different disease conditions. Therefore, IVIg has become not only a substitution therapy for patients with immunodeficiencies [78], but also a therapeutic agent in autoimmune and systemic inflammatory diseases [79], as well as in organ and bone marrow transplantation [3,80].
IVIg is extensively used in patients with end-stage organ disease as well as allograft recipients. High levels of HLA antibodies, caused by various sensitizing events such as previous transplantation, pregnancy, or blood transfusion, are observed in patients with end-stage organ disease. High levels of such allo-HLA Abs can more likely produce positive crossmatch results with potential organ donors and preclude transplantation. Consequently, antibody-positive patients may experience prolonged waiting time. Among renal transplant recipients alone, such sensitized patients constitute more than one-third of those on the waiting list. For highly sensitized patients (with a panel-reactive HLA antibody (PRA) greater than 80%), the prospects of transplantation are grim.
The formation of Abs against allo-antigens depends on both T and B-cells. Therefore, aggressive suppressive strategies have been developed to deplete both T and B-cells in order to reduce the generation of allo-HLA Abs formed before and after transplantation. One such strategy is induction therapy with rabbit or horse anti-human thymocyte globulin, a polyreactive, polyclonal mixture of non-specific cytotoxic Abs capable of killing immune cells [81]. However, many clinical transplant centers worldwide have formulated alternate protocols to suppress the formation of anti-HLA Abs. These protocols may include plasmapheresis (PP), high-dose IVIg, or a combination of PP with low-dose IVIg [2,49,50,51,52,53,54,82,83,84,85,86,87] or Rituximab, a monoclonal Ab (mAb) that depletes CD20+ B-cells [88,89,90,91]. Although several immunotherapeutic potentials are attributed to IVIg, its mechanism of action is far from certain. Possibly, it is due to polyclonality and the mixture of several kinds of IgG Abs present, including Abs against all HLA class I loci and alleles, as illustrated in Table 6, and Figure 5A,B.
A most interesting finding [35] was that the HLA-Ia reactivity of IVIg was significantly abolished when anti-HLA-E Abs were depleted, specifically by passing IVIg through HLA-E heavy chain-conjugated Affi-gel affinity columns. This suggested that IVIg’s HLA-Ia reactivity could possibly be due to the presence of HLA-E-specific IgG Abs, and that there were anti-HLA-E mAbs that might simulate the HLA reactivity of IVIg.
These observations led us to hypothesize that the anti-HLA-E mAbs that simulated the HLA-reactivity of IVIg could mimic IVIg by suppressing B-cells from producing Abs. We compared the efficacy of IVIg versus that of mAb TFL-007 (HLA-I polyreactive, anti-HLA-E mAb) (Table 4) in suppressing the B-cell blastogenesis, proliferation, and production of Abs.

5.2.2. Methodology to Test the Hypothesis

More details are presented elsewhere [92]. Two commercial IVIg preparations were used. They were (1) IVIg-GamaSTAN™ (Lot 26NJ651; Talecris Biotherapeutics, Inc., Research Triangle Park, NC, USA) formulated as a 15–18% protein solution at a pH of 6.4–7.2 in 0.21–0.32 M glycine and, (2) IVIgGamunex®-C (Lot 26NKLG1, Talecris), a solution at a pH of 6.4–7.2 in 0.16–0.24 M glycine, albumin < 20 μg/mL. The HLA-I polyreactive HLA-E mAbs used were TFL-007s (culture supernatant) and TFL-007a (ascites). For suppressing antibody production by B-cells, two different experiments were carried out:
Experiment # 1 was on freshly purified B-cells from the peripheral blood lymphocytes of a woman alloimmunized with her husband’s HLA DRB1*0101 antigens during her first pregnancy.
The HLA typing of the woman, her husband, and their two daughters (first, 23 years; second, 18 years) revealed that both the father and the first daughter carried the DRB1*0101 allele, while the mother’s sera showed the prevalence of high levels of allo-antibody against DRB1*0101. Periodic screening indicated that the high MFIs of the primary allo-HLA Abs had persisted for the past two years. Most likely, the anti-DRB1*0101 IgG Abs with high MFI were formed as a consequence of alloimmunization during a pregnancy that occurred 23 years before, which suggested the prevalence of both long-lived memory B-cells and bone marrow-resident plasma cells. Because this alloantibody was bound to the husband’s primary allele, the antibody was designated as the ‘primary alloantibody’.
Therefore, her peripheral blood B-cells were isolated and purified after obtaining her informed consent and institutional (TFL) approval. The B-cells were purified from the PBMC by positive selection, using CD19 Pan B Dynabeads® magnetic beads (Invitrogen, Life Technologies Corporation, Carlsbad, CA, USA), and detached using DETACHaBEAD® CD19 (Invitrogen). Purified B-cells (>95% CD19+) were plated at 0.2 × 106/200 μL/well in a sterile, 96-well plate (ThermoFisher Scientific, Inc., Waltham, MA, USA) and cultured in Iscove’s Modified Dulbecco’s medium, containing HEPES, L-glutamine, and sodium pyruvate (Gibco-Invitrogen) supplemented with AB human serum (10%), recombinant human (rh) insulin (5 μg/mL), rh-transferrin (50 μg/mL), gentamycin (25 μg/mL), and 2-mercaptoethanol (50 μM). The resting B-cells were activated with rh-IL-2 (50 ng/mL), rhIL-4 (100 ng/mL), rhIL-6 (100 ng/mL), rhIL-10 (50 ng/mL), and human CD40 antibody (1 μg/mL) [92]. The B-cell population (CD19+) isolated from PBMC, using positive selection on day 0, consisted of a major fraction including naive B-cells (CD20+/CD27−/CD38+/−) (74.47%), B-memory cells (CD20+/CD27+/CD38−) (8.47%), and plasma cells (CD20−/CD27++/CD38++) (0.26%). These cells, upon activation by the selected battery of cytokines IL-2/IL-4/IL-6/IL-10/IL-21 (at a 1:4:4:2:2 ratio) and human CD40 antibody (1 μg/mL) for seven days, resulted in an increase in plasma cells from 0.26% on day 0 to 36.25% on day 7. On day 7, culture supernatants [10 μL] from each well were analyzed for anti-HLA, class II IgG alloAbs. Cells from the positive wells were further harvested, washed (3x), seeded, and activated again as above. On days 8 and 9, the culture supernatants were screened for Abs. After ascertaining the consistency of the MFIs of the Abs on days 8 and 9, the cells were pooled, washed (3X), and aliquoted. They were maintained in culture without any cytokine activators or anti-CD40 antibody for an additional 3 days. The culture supernatants [10 μL] from each well were analyzed for Abs at 0, 12, 24, 48, and 72 h.
On day 9, the cells were pooled, aliquoted, and maintained without the cytokine combo or anti-CD40 mAb. These wells were exposed to medium or IVIg (1/100, 1.5 mg/mL) or mAb TFL-007s (1/100, 5 μg/mL) for 72 h. To study the effect of IVIg on the secretion of allo-HLA IgG Abs, we used IVIg at a protein concentration 300-fold higher than that of the purified culture supernatant of TFL-007s (5 μg/mL) used in the treatment of B-cells in culture. The supernatants recovered from the respective wells were screened for the HLA-alloAbs.
Experiment # 2 was on the human hybridoma cell line HML16, generated from the resting B-cells of a multiparous woman.
The human hybridoma cell line, HML16, produced anti-HLA, class I alloAbs with differing MFIs: high against B*0702, B*8101, B*6701, and B*4201; and low against B*2708, B*2705, B*5501, B*5601, and B*8201. The cell line was cultured in RPMI-1640, as described earlier. The cells were seeded at 1000/100 μL/well in a Falcon 96-well, flat-bottomed plate and divided into different treatment groups: Group 1, medium control; Group 2, mouse IgG control; Group 3, mAb TFL-007 (ascites); Group 4, IVIg (GamaSTAN); and Group 5, IVIg (Gamunex-C). The following sub-groups were established: mouse IgG control (100 and 50 μg/mL); GamaSTAN–IVIg subgroups were at dilutions 1:10 (15 mg/mL), 1:20 (7.5 mg/mL), and 1:40 (3.75 mg/mL); Gamunex-IVIg subgroups were at dilutions 1:10 (10 mg/mL), 1:20 (5 mg/mL), and 1:40 (2.5 mg/mL); and mAb TFL-007a subgroups were at dilutions 1:10 (100 μg/mL), 1:20 (50 μg/mL), 1:40 (25 mg/mL), and 1:80 (12.5 μg/mL). Twenty μL of culture supernatant from each well were analyzed for allo-HLA Abs at 0 and 72 h.
The expression of CD19 was monitored using the fluorescein isothiocyanate (FITC)-labeled, anti-human CD19 (mAb HIB19). On days 0 and 7, both resting and activated B-cells were stained with phycoerythrin (PE) anti-human CD20 (mAb 2H7), peridinin chlorophyll (PerCP) antihuman CD27 (mAb 0323), and FITC anti-human CD38 (mAb HIT2) to examine the differential activation of B-cells. The source of the mAbs was from BioLegend. Prior to staining with Abs, Human TruStain FcX™ (BioLegend, San Diego, CA, USA) was used to block FcR-involved, unwanted staining.

5.2.3. TFL-007 Suppressed HLA-Antibody Production Better Than That of IVIg

In the first experiment, both the sera of the woman and of those secreted by activated memory B-cells (culture supernatants) showed the presence of several alloAbs directed against DRB1*0102, DRB1*0404, DRB1*0405, DRB1*1402, and DRB1*0401, in addition to the primary alloantibody, anti-DRB1*0101 IgG. The secondary alloAbs were not directed against the husband’s alleles. They might have represented cross-reactive alloAbs in that they occurred in cultures containing the primary alloantibody, anti-DRB1*0101. These alleles shared amino acids or amino acid sequences with the primary allele, DRB1*0101. The details were presented elsewhere [92].
Figure 10 documents that the GamaSTAN IVIg suppressed the secretion of the primary alloantibody against DRB1*0101 at different time points (p2 < 0.01). Similarly, the HLA polyreactive mAb TFL-007s also significantly reduced the secretion of the primary alloantibody (p2 < 0.0005). However, the suppression of the secretion of the primary alloantibody by the mAb TFL-007s was highly significant compared to the IVIg-induced suppression.
In the second experiment, the treatment effects of two preparations of IVIg (GamaSTAN and Gamunex) were tested on HM16 at different dilutions and protein concentrations and compared with the media control [92]. The IVIg concentration used for the hybridoma cell line HML16 was comparable to the high-dose IVIg used for desensitization and post-transplant therapy. Neither of the IVIg preparations showed any significant suppression of the secretion of allo-HLA-B IgG by the hybridoma cells. In contrast, the mAb TFL-007a had a strikingly significant suppressive effect on the secretion of both HLA-B*0702 and B*8101. More importantly, the mAb TFL-007a showed dosimetric suppression of allo-HLA Abs. When HML16 was treated with the highest concentration of TFL-007a (100 μg/mL), suppression was 33% for B*0702 and 34% for B*8101, compared with the medium control group. When the dosage of TFL007a was decreased, the suppression effect declined. In short, in marked contrast to the IVIg preparations, the HLA-I polyreactive mAb TFL-007a significantly suppressed the secretion of both allo-HLA-B Abs.

5.3. Expansion of Foxp3+ Tregs In Vitro: IVIg versus HLA-I Polyreactive mAbs

Human CD4+CD25+Foxp3+ regulatory T-cells are a naturally occurring population of regulatory T-cells (Tregs) in circulation [93,94]. Their presence in liver allografts is attributed to tolerance of the transplanted organ [95,96,97,98,99,100,101]. They suppress Ab production by downregulating B memory and plasma cells [102] and depleting both CD4+ [103] and CD8+ [104,105] T-cells, and hence, they play a major role in graft tolerance [101,106,107]. While performing skin graft experiments on human-CD52 transgenic CP1-CBA/Ca (H-2k) mice, Garca et al. [106] observed that the “T cell suppression of graft rejection is an active process that operates beyond secondary lymphoid tissue, and involves the persistent presence of regulatory T-cells at the site of the tolerated transplant.” (p. 1641).
The therapeutic mAb, tocilizumab, given to patients with rheumatoid arthritis, increases T-regs and correlates with clinical response [108]. Upregulation of T-regs by IVIg is considered a critical factor in controlling experimental autoimmune encephalomyelitis; IVIg is known to upregulate T-regs [109].
Because IVIg can upregulate T-regs, it is hypothesized that the HLA-I polyreactive mAbs TFL-006 and TFL-007 may also induce proliferation of T-regs. For testing this hypothesis, CD4+CD25+foxp3+ Tregs were obtained from the peripheral blood of normal and healthy donors after obtaining necessary consent and institutional IRB approval. A variety of cell surface markers, including CD4, CD25 (IL-2Rα), CD45RA, and FoxP3, were monitored, using their respective monoclonal Abs.
We compared the impact of different commercial preparations of IVIg and the HLA-I polyreactive mAb TFL-007 in triplicate on untreated T-regulatory cells (CD4+/CD25+/FoxP3+) obtained from the blood of a healthy volunteer from TFL. The mAb purified from ascites was used throughout. Figure 11 illustrates that the different commercial preparations of IVIg at two different dilutions (1/10 and 1/80) failed to upregulate the Tregs, while the mAb TFL-007a showed a significant increase in the number of cells as compared to controls.

6. Discussion

IVIg is a mixture of polyclonal IgG Abs, pooled and purified from thousands of normal individuals. The binding affinity of IVIg is multivarious because the IgG Abs in IVIg can bind to blood groups, MHC complex antigens, cytokines, chemokines and their receptors, and several other antigens including human albumin. Most importantly, in the last three decades [2,3,49,50,51,52,53,54,55,56,57,82,83,84,85,86,87,88,89,90,91], IVIg has been administered to HLA-sensitized patients who possess a higher level of HLA allo-Abs, with the intention to lower these Abs. Due to the high level of these allo-HLA Abs, such patients are more likely to have a positive crossmatch result with potential organ donors pre-transplantation, and they often languish for years on the waiting list. For highly sensitized patients, the prospects of transplantation get grim. Realizing the imminent need to lower the impact of HLA sensitization, the US FDA approved IVIg for therapeutic administration in HLA-sensitized patients. However, due to its lack of efficacy as a monotherapy [55,56,57], IVIg is often combined with other therapeutic agents [89,90,91] such as plasmapheresis and rituximab (a mAb that depletes CD20+ B-cells). Commercial therapeutic preparations of IVIg, formulated in different countries, possess allo-HLA IgG Abs against almost all alleles of all six loci of HLA-I [35,57]. In this regard, HLA polyreactive mAbs developed from HLA-E αHCs mimic the allo-HLA antibody profile of IVIg [the U.S. Patent 10,800,847; 13 October 2020].
The structure of a single HLA-I antigen has two different profiles, as illustrated in Figure 2. The most well-known profile is the cell surface heteromer, consisting of α-HC associated with β2m (Figure 1). In the heteromeric profile, many of the most commonly shared amino acid sequences (Table 1 and Table 2), such as 117AYDGKDY123 and 127LNEDLRSWTA135 are cryptic, hidden by β2m. The second less-known profile of a single HLA-I antigen is a β2m-free a-HC, i.e., an OC (Figure 2). Although this structure is naturally occurring, it is often misconstrued to be identical to denatured HLA antigens, as found on alkali or acid-treated SABs [46,110]. In fact, the misconception that the monomeric versions of naturally occurring HLA molecules are “denatured” HLA is well-documented in several reports [13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30]. These reports demonstrate several novel aspects of the monomeric versions. The shared amino acid sequences common to all six loci of HLA are exposed for immune recognition and serve as receptors for signal transduction. Notably, the long cytoplasmic tails of the monomeric versions on cells with tyrosyl and seryl residues (Figure 2) are shown to be involved in signal transduction (Figure 9). Arosa et al. [19,111] elucidated further the difference between the intact HLA antigens, as CCs, and the monomeric variants, as OCs, when expressed in vivo on the cell surface (Figure 4). One difference was that HLA molecules shed from the cell surface [112] occurred as monomeric variants, or OCs, in the circulation (Figure 3). Since they exposed cryptic epitopes, they served as immunogens for allo-HLA Ab production. Indeed, the immunogenicity and antigenicity of the shared cryptic epitope 117AYDGKDY123 were much greater than other epitopes (Table 2).
Visualizing the antibody recognition sites (epitopes) of CCs and OCs would clarify and elucidate the HLA profile instrumental for generation of HLA-I polyreactive IgG mAbs and naturally occurring IgG Abs. Theoretically, one can expect the presence of polyreactive IgG Abs recognizing the OCs of HLA in IVIg. Indeed Figure 5 confirms the prevalence of two commercial preparations of IVIg reacting to monomeric variants on the acid denatured SABs. The density of IgG binding to monomeric variants was much higher than those recognizing the CCs on ‘iBeads’ (Figure 5). Kaveri et al. [59] pointed out “Abs to a conserved region (cryptic domain) of HLA class I molecules, capable of modulating CD8 T cell-mediated function, are present in pooled normal immunoglobulin for therapeutic use” (p. 865). Strikingly, HLA-polyreactive IgG2a mAbs (TFL-006 and TFL-007) do not recognize CCs, but recognize only the OCs on the SABs (Table 5). Importantly, as noted above, these naturally occurring OCs existing on the cell surface in vivo should not be considered synonymous with chemical treatment (acid or alkali) on synthetic beads disrupting intact CCs to produce denatured α-HCs in vitro.
The binding of the HLA-I polyreactive mAbs to OCs is responsible for the suppression of blastogenesis and proliferation. It may involve the reversal of phases of activation of T-lymphocytes, mediated by signal transduction. The elongation of the cytoplasmic tail of the HLA-I OCs exposes otherwise cryptic tyrosine-320 [76] and serine-335 [113] residues, with a provision for phosphorylation (Figure 9). Although serine-335 is generally considered the primary site of phosphorylation in this tail, the phosphorylation of tyrosine-320 has been indicated by others [76]. Thus, the HLA-I OCs in activated T-cells are associated with tyrosine phosphorylation and are capable of enabling cis interactions with cell surface receptors or other signaling molecules [76,77,113,114,115,116]. The binding by TFL mAbs may result in dephosphorylation of the cytoplasmic tails of CD3 molecules by activating phosphatases. The result is to arrest transcription factors and inhibit the synthesis of the proteins involved in blastogenesis and mitosis (Figure 9). These events suggest that the suppression of the activation of T-cells could be due to the binding of HLA-I polyreactive mAbs, mimicking the HLA-I polyreactivity of IVIG, to the shared amino acid sequences exposed on the naturally occurring OCs of HLA-I molecules (Figure 2). This activation involves not one HLA-I locus but all alleles of the six loci (HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, and HLA-G) expressed on the surface of activated T-cells. The efficacy of the monoclonality of the HLA-I polyreactive mAbs and their F(ab′)2 binding is restricted to OCs. Furthermore, poor efficacy of IVIg is due to admixture with CC-binding Abs, other non-HLA Abs, anti-idiotypic Abs, immune complexes, and other chemicals such as sugars added to render stability to IVIg.
Possibly, the same or similar phosphorylation and dephosphorylation mechanisms may be involved in suppressing antibody production by B-cells. The HLA-I polyreactive mAb, but not IVIg, suppressed allo-HLA-I and allo-HLA-II Abs production by B-memory cells and immortalized B-cells. While monitoring the efficacy of the HLA-I polyreactive mAbs, the cytokine combination and anti-CD40 antibody were both removed to precisely evaluate the impact of the antibody. Possibly, HLA-I polyreactive mAbs may also help to suppress other Abs produced by B-cells and alloAbs as well.
In addition, the HLA-I polyreactive mAbs upregulated T-regs better than IVIg (Figure 11). T-regs are well known for their immunoregulatory properties. They suppress Ab production by downregulating B-memory and plasma cells [102] and by depleting CD4+ [103] and CD8+ [104,105] T-cells. We believe that both IVIg and the HLA-I polyreactive TFL mAbs perform the immunosuppressive functions stated above, including the upregulation of T-regs, by binding to the OCs of HLA.

7. Conclusions

The observations point out conclusively that IVIg (a) suppressed blastogenesis and proliferation of T-cells, (b) minimized the HLA-II allo-antibody production by B-memory cells of parous women and HLA-I antibody production of an immortalized cell line, and (c) expanded T-regs. These effects could be due to the HLA OC-polyreactive Abs present in IVIg. These findings are further strengthened by the several similarities observed in the nature and functional characteristics of IVIg and HLA-I polyreactive, OC-specific TFL mAbs (TFL-006 and TFL-007) (Table 7). The mAbs, which recognize shared epitopes on naturally occurring OCs, with no ability to bind to the CCs, perform the same suppressive functions better than the different preparations of IVIg. Possibly, anti-CC Abs present in IVIg may impact their above-mentioned immunomodulatory functions. Hence, HLA-I polyreactive TFL mAbs are capable of serving as IVIg-mimetics, perhaps more efficiently than IVIg itself. Clinical trials are clearly warranted. Possibly, humanized versions of these TFL-mAbs, either combined or alone, can be better therapeutic tools than IVIg to suppress HLA sensitization and minimize antibody production post-transplantation.

Author Contributions

All authors jointly studied the literature and formulated the concept of the review, after discussions. The first author generated the first version of the review, which further developed by the other two authors. The third author extensively revised the final version from the clinical perspective. All authors have read and agreed to the published version of the manuscript.

Funding

This research utilizes the funds received from Mark Terasaki, first son of Late Prof. Paul Terasaki and Terasaki Foundation Laboratory.

Institutional Review Board Statement

This article is a review based on two major in vitro investigations carried out by Terasaki Foundation Laboratory, which resulted in two original research articles (58, 92). Healthy sera of TFL volunteers and on sera from Japan was obtained by Late Terasaki after obtaining informed consent. The experiments were conducted between 2013 and 2015, according to the guidelines of the Declaration of Helsinki, and approved by the Institutional Review Board of Terasaki Foundation laboraotory. TFL is not afflicated with any universiites or hosptials and it is a private research institue. For details, refer to the original publications (58, 92). The hybridomas of the mAbs were raised at One Lambda Inc in 2012, owned by Late Paul Terasaki, It had animal research approval.

Informed Consent Statement

TFL has obtained informed consents from a normal and healthy male (T cell studies [58]) and from a normal healthy mother (B cell study [92]) of working at TFL between 2013–2015.

Data Availability Statement

Data are available with the first author of each investigation [58,92]/./;[−00,847; 13 October 2020).

Acknowledgments

The experiments reported in this review were carried out at Terasaki Foundation Laboratory in Santa Monica, California with the guidance of the late Paul Ichiro Terasaki, and with the active and enthusiastic involvement of several dynamic research associates. Luminex Single Antigen Bead immunoassays for monitoring HLA-I reactivities of IVIg and the TFL mAbs and the ex-periments related to CD4+ T-cells were assisted by the following research associates: Tho Pham, Vadim Jucaud, and Satoru Kawakita; the experiments related to B-cells were carried out by Dong Zhu, T. Miyazaki, ‡ Tho Pham, and Vadim Jucaud; and the experiments related to T-regs were performed by Michiko Taniguchi. The current report has been encouraged and financially sup-ported by the funds from Mark Terasaki, first son of the late Paul Terasaki. The first author (MHR) dedicates this review to his mentor, the late Paul Ichiro Terasaki, whose constant discus-sions, both at his office and at weekly seminar, molded the thought process for this review. In addition, Terasaki is a co-inventor, with the first author, of the patent entitled Anti-HLA class-Ib antibodies mimic immunoreactivity and immunomodulatory functions of intravenous immu-noglobulin (IVIg) useful as therapeutic IVIg mimetics and methods of their use. (U.S. Patent 10,800,847; 13 October 2020).

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Darabi, K.; OAbdel-Wahab, O.; Dzik, W.H. Current usage of intravenous immune globulin and the rationale behind it: The Massachusetts General Hospital data and a review of the literature. Transfusion 2006, 46, 741–753. [Google Scholar] [CrossRef]
  2. Glotz, D.; Haymann, J.-P.; Sansonetti, N.; Francois, A.; Menoyo-Calonge, V.; Bariety, J.; Druet, P. Suppression of HLA-specific alloAbs by high-dose intravenous immunoglobulins (IVIg). Transplantation 1993, 56, 335–337. [Google Scholar] [CrossRef] [PubMed]
  3. Tyan, D.B.; Li, V.A.; Czer, L.; Trento, A.; Jordan, S.C. Intravenous immunoglobulin suppression of HLA alloantibody in highly sensitized transplant candidates and transplantation with a histoincompatible organ. Transplantation 1994, 57, 553–562. [Google Scholar] [CrossRef]
  4. Sapir, T.; Shoenfeld, Y. Facing the enigma of immunomodulatory effects of intravenous immunoglobulin. Clin. Rev. Aller. Immunol. 2005, 29, 185–199. [Google Scholar] [CrossRef]
  5. Tongio, M.M.; Falkenrodt, A.; Mitsuishi, Y.; Urlacher, A.; Bergerat, J.P.; North, M.L.; Mayer, S. Natural HLA Abs. Tissue Antigens. 1985, 26, 271–285. [Google Scholar] [CrossRef] [PubMed]
  6. Luscher, M.A.; Choy, G.; Embree, J.E.; Nagelkerke, N.J.; Bwayo, J.J.; Nienga, S.; Plummer, F.A.; Barber, B.H.; MacDonald, K.S. Anti-HLA alloAb is found in children but does not correlate with a lack of HIV type 1 transmission from infected mothers. AIDS Res. Hum. Retrovir. 1998, 14, 99–107. [Google Scholar] [CrossRef]
  7. Morales-Buenrostro, L.E.; Terasaki, P.I.; Marino-Vazquez, L.A.; Lee, J.-H.; El-Awar, N.; Alberú, J. “Natural” human leukocyte antigen Abs found in nonalloimmunized healthy males. Transplantation 2008, 86, 1111–1115. [Google Scholar] [CrossRef] [PubMed]
  8. Zhou, B.; Saito, S.; Nakazawa, Y.; Kobayashi, N.; Matsuda, M.; Matsumoto, Y.; Hosoyama, T.; Koike, K. Existence of an immunoglobulin G component of naturally occurring HLA class I Abs that are not directed against self-antigens in human serum. Tissue Antigens. 2008, 72, 98–104. [Google Scholar] [CrossRef] [Green Version]
  9. Ravindranath, M.H.; Kaneku, H.; El-Awar, N.; Morales-Buenrostro, L.E.; Terasaki, P.I. Abs to HLA-E in alloimmunized males: Pattern of HLA-Ia reactivity of anti-HLA-E-positive sera. J. Immunol. 2010, 185, 1935–1948. [Google Scholar] [CrossRef] [Green Version]
  10. Ravindranath, M.H.; Taniguchi, M.; Chen, C.W.; Ozawa, M.; Kaneku, H.; El-Awar, N.; Cai, J.; Terasaki, P.I. HLA-E mAbs recognize shared peptide sequences on classical HLA class Ia:relevance to human natural HLA Abs. Mol. Immunol. 2010, 47, 1121–1131. [Google Scholar] [CrossRef]
  11. Ravindranath, M.H.; Pham, T.; El-Awar, N.; Kaneku, H.; Terasaki, P.I. Anti-HLA-E mAb 3D12 mimics MEM-E/02 in binding to HLA-B and HLA-C alleles: Web-tools validate the immunogenic epitopes of HLA-E recognized by the Abs. Mol. Immunol. 2011, 48, 423–430. [Google Scholar] [CrossRef]
  12. Marsh, S.G.E.; Parham, P.; Barber, L.D. The HLA Facts Book; Academic Press: San Diego, CA, USA, 2000; 400p. [Google Scholar]
  13. Schnabl, E.; Stockinger, H.; Majdic, O.; Gaugitsch, H.; Lindley, I.J.; Maurer, D.; Hajek-Rosenmayr, A.; Knapp, W. Activated human T lymphocytes express MHC class I heavy chains not associated with beta 2 m. J. Exp. Med. 1990, 171, 1431–1442. [Google Scholar] [CrossRef]
  14. Schumacher, T.N.; Heemels, M.T.; Neefjes, J.J.; Kast, W.M.; Melief, C.J.; Ploegh, H.L. Direct binding of peptide to empty MHC class I molecules on intacT-cells and in vitro. Cell 1990, 62, 563–567. [Google Scholar] [CrossRef]
  15. Benjamin, R.J.; Madrigal, J.A.; Parham, P. Peptide binding to empty HLA-B27 molecules of viable human cells. Nature 1991, 351, 74–77. [Google Scholar] [CrossRef]
  16. Majdic, O.; Schnabl, E.; Stockinger, H.; Gadd, S.; Maurer, D.; Radaszkiewics, T. LA45, an activation-induced human lymphocyte antigen with strong homology to MHC class I molecules. In Leukocyte Typing IV; Oxford University Press: Oxford, UK, 1989; Volume 511, 8p. [Google Scholar]
  17. Madrigal, J.A.; Belich, M.P.; Benjamin, R.J.; Little, A.M.; Hildebrand, W.H.; Mann, D.L.; Parham, P. Molecular definition of a polymorphic antigen (LA45) of free HLA-A and -B heavy chains found on the surfaces of activated B and T-cells. J. Exp. Med. 1991, 174, 1085–1095. [Google Scholar] [CrossRef] [Green Version]
  18. Santos, S.G.; Simon, J.; Powis, S.J.; Arosa, F.A. Misfolding of Major Histocompatibility Complex Class I Molecules in Activated T-cells Allows cis-Interactions with Receptors and Signaling Molecules and Is Associated with Tyrosine Phosphorylation. J. Biol. Chem. 2004, 279, 53062–53070. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  19. Arosa, F.A.; Santos, S.G.; Powis, S.J. OC: The hidden face of MHC-I molecules. Trends Immunol. 2007, 28, 115–123. [Google Scholar] [CrossRef]
  20. Demaria, S.; Schwab, R.; Bushkin, Y. The origin and fate of beta 2m-free MHC class I molecules induced on activated T-cells. Cell Immunol. 1992, 142, 103–113. [Google Scholar] [CrossRef]
  21. Demaria, S.; Bushkin, Y. CD8 and beta-2 m-free MHC class I molecules in T cell immunoregulation. Int. J. Clin. Lab. Res. 1993, 23, 61–69. [Google Scholar] [CrossRef] [PubMed]
  22. Raine, T.; Brown, D.; Bowness, P.; Hill Gaston, J.S.; Moffett, A.; Trowsdale, J.; Allen, R.L. Consistent patterns of expression of HLA class I free heavy chains in healthy individuals and raiAllensed expression in spondyloarthropathy patients point to physiological and pathological roles. Rheumatology 2006, 45, 1338–1344. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  23. Allen, R.L.; O’Callaghan, C.A.; McMichael, A.J.; Bowness, P. Cutting edge: HLA-B27 can form a novel beta2m-free H chain homodimer structure. J. Immunol. 1999, 162, 5045–5048. [Google Scholar] [PubMed]
  24. Khare, S.D.; Hansen, J.; Luthra, H.S.; David, C.S. HLA-B27 heavy chains contribute to spontaneous inflammatory disease in B27/human beta2m (beta2m) double transgenic mice with disrupted mouse beta2m. J. Clin. Investig. 1996, 98, 2746–2755. [Google Scholar] [CrossRef] [PubMed]
  25. Capps, G.G.; Robinson, B.E.; Lewis, K.D.; Zúñiga, M.C. In vivo dimeric association of class I MHC heavy chains. Possible relationship to class I MHC heavy chain-beta 2m dissociation. J. Immunol. 1993, 151, 159–169. [Google Scholar] [PubMed]
  26. Matko, J.; Bushkin, Y.; Wei, T.; Edidin, M. Clustering of class I HLA molecules on the surfaces of activated and transformed human cells. J. Immunol. 1994, 152, 3353–3360. [Google Scholar]
  27. Allen, R.L.; Raine, T.; Haude, A.; Trowsdale, J.; Wilson, M.J. Leukocyte receptor complex-encoded immunomodulatory receptors show differing specificity for alternative HLA-B27 structures. J. Immunol. 2001, 167, 5543–5547. [Google Scholar] [CrossRef] [Green Version]
  28. Demaria, S.; Schwab, R.; Gottesman, S.R.; Bushkin, Y. Soluble beta 2-m-free class I heavy chains are released from the surface of activated and leukemia cells by a metalloprotease. J. Biol. Chem. 1994, 269, 6689–6694. [Google Scholar] [CrossRef]
  29. Nissen, M.H.; Claësson, M.H. Proteolytically modified human beta 2-microglobulin augments the specific cytotoxic activity in murine mixed lymphocyte culture. J. Immunol. 1987, 139, 1022–1029. [Google Scholar]
  30. Nissen, M.H. Proteolytic modification of beta 2-microglobulin in human serum. Dan. Med. Bull. 1993, 40, 56–64. [Google Scholar]
  31. Chou, P.Y.; Fasman, G.D. Prediction of the secondary structure of proteins from their amino acid sequence. Adv. Enzymol. Relat. Areas Mol. Biol. 1978, 47, 45–148. [Google Scholar] [CrossRef]
  32. Kolaskar, A.S.; Tongaonkar, P.C. A semi-empirical method for prediction of antigenic determinants on protein antigens. FEBS Lett. 1990, 276, 172–174. [Google Scholar] [CrossRef] [Green Version]
  33. Karplus, P.A.; Schulz, G.E. Prediction of chain flexibility in proteins—A tool for the selection of peptide antigens. Naturwissenschaft 1985, 72, 212–213. [Google Scholar] [CrossRef]
  34. Parker, J.M.; Guo, D.; Hodges, R.S. New hydrophilicity scale derived from high-performance liquid chromatography peptide retention data: Correlation of predicted surface residues with antigenicity and X-ray-derived accessible sites. Biochemistry 1986, 25, 5425–5432. [Google Scholar] [CrossRef]
  35. Ravindranath, M.H.; Terasaki, P.I.; Pham, T.; Jucaud, V.; Kawakita, S. Therapeutic preparations of IVIg contain naturally occurring anti-HLA-E Abs that react with HLA-Ia (HLA-A/-B/-Cw) alleles. Blood 2013, 121, 2013–2028. [Google Scholar] [CrossRef] [Green Version]
  36. Ravindranath, M.H.; Zhu, D.; Pham, T.; Jucaud, V.; Hopfield, J.; Kawakita, S.; Terasaki, P.I. Anti-HLA-E mAbs reacting with HLA-la and lb alleles like IVIg as potential IVIg-immunomimetics: An evolving therapeutic concept. Clin. Transpl. 2013, 293–305. [Google Scholar]
  37. Ward, P.A.; Adams, J.; Faustman, D. Monoclonal Antibody Production A Report of the; Committee on Methods of Producing MAbs Institute for Laboratory Animal Research National Research Council National Academy Press: Washington, DC, USA, 1999; pp. 1–47. [Google Scholar]
  38. Sasaki, T.; Ravindranath, M.H.; Terasaki, P.I.; Freitas, M.C.; Kawakita, S.; Jucaud, V. Gastric cancer progression may involve a shift in HLA-E profile from an intact heterodimer to β2m-free monomer. Int. J. Cancer 2014, 134, 1558–1570. [Google Scholar] [CrossRef] [PubMed]
  39. Parham, P.; Barnstable, C.J.; Bodmer, W.F. Use of a monoclonal antibody (W6/32) in structural studies of HLA-A,B,C, antigens. J. Immunol. 1979, 123, 342–349. [Google Scholar] [PubMed]
  40. Smith, K.D.; Mace, B.E.; Valenzuela, A.; Vigna, J.L.; McCuthcheon, J.A.; Barbosa, J.A.; Huczko, E.; Engelhard, V.H.; Lutz, C.T. Probing HLA-B7 conformational shifts induced by peptide-binding groove mutations and bound peptide with anti-HLA mAbs. J. Immunol. 1996, 157, 2470–2478. [Google Scholar] [PubMed]
  41. Vigna, J.L.; Smith, K.D.; Lutz, C.T. Invariant chain association with MHC class I: Preference for HLA class I/beta 2-m heterodimers, specificity, and influence of the MHC peptide-binding groove. J. Immunol. 1996, 157, 4503–4510. [Google Scholar]
  42. Perosa, F.; Luccarelli, G.; Prete, M.; Favoino, E.; Ferrone, S.; Dammacco, F. Beta 2-m-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide. J. Immunol. 2003, 171, 1918–1926. [Google Scholar] [CrossRef] [Green Version]
  43. Carreno, B.M.; Hansen, T.H. Exogenous peptide ligand influences the expression and half-life of free HLA class I heavy chains ubiquitously detected at the cell surface. Eur. J. Immunol. 1994, 24, 1285–1292. [Google Scholar] [CrossRef]
  44. Ravindranath, M.H.; El Hilali, F. Monospecific and Polyreactive MAbs against Human Leukocyte Antigen-E: Diagnostic and Therapeutic Relevance. In Monoclonal Antibodies; Resaei, N., Ed.; Intech Open: London, UK, 2021; 38p, ISBN 978-1-83968-370-1. [Google Scholar]
  45. Jucaud, V.; Ravindranath, M.H.; Terasaki, P.I. Conformational Variants of the Individual HLA-I Antigens on Luminex Single Antigen Beads Used in Monitoring HLA Abs: Problems and Solutions. Transplantation 2017, 101, 764–777. [Google Scholar] [CrossRef] [PubMed]
  46. Ravindranath, M.H.; Jucaud, V. Conformational variants of HLA-I antigens on Luminex Single Antigen Beads for monitoring Abs. Transplantation 2017, 101, e153–e154. [Google Scholar] [CrossRef] [PubMed]
  47. Ravindranath, M.H.; Jucaud, V.; Ferrone, S. Monitoring native HLA-I trimer specific Abs in Luminex multiplex single antigen bead assay: Evaluation of beadsets from different manufacturers. J. Immunol. Methods 2017, 450, 73–80, Erratum in 2018, 460, 125. [Google Scholar] [CrossRef] [PubMed]
  48. Ravindranath, M.H. HLA Class Ia and Ib Polyreactive Anti-HLA-E IgG2a MAbs (TFL-006 and TFL-007) Suppress Anti-HLA IgG Production by CD19+ B-cells and Proliferation of CD4+ T-cells While Upregulating Tregs. J. Immunol. Res. 2017, 2017, 3475926. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  49. Jordan, S.C.; Quartel, A.W.; Czer, L.S.; Admon, D.; Chen, G.E.; Fishbein, M.C.; Schwieger, J.; Steiner, R.W.; Davis, C.; Tyan, D.B. Posttransplant therapy using high-dose human immunoglobulin (intravenous gammaglobulin) to control acute humoral rejection in renal and cardiac allograft recipients and potential mechanism of action. Transplantation 1998, 66, 800–805. [Google Scholar] [CrossRef]
  50. Jordan, S.C.; Vo, A.; Bunnapradist, S.; Toyoda, M.; Peng, A.; Puliyanda, D.; Kamil, E.; Tyan, D. Intravenous immune globulin treatment inhibits crossmatch positivity and allows for successful transplantation of incompatible organs in living-donor and cadaver recipients. Transplantation 2003, 76, 631–636. [Google Scholar] [CrossRef]
  51. Perez, E.E.; Orange, J.S.; Bonilla, F.; Chinen, J.; Chinn, I.K.; Dorsey, M.; El-Gamal, Y.; Harville, T.O.; Hossny, E.; Mazer, B.; et al. Update on the use of immunoglobulin in human disease: A review of evidence. J. Allergy Clin. Immunol. 2017, 139, S1–S46. [Google Scholar] [CrossRef] [Green Version]
  52. Jordan, S.C.; Toyoda, M.; Vo, A.A. Intravenous immunoglobulin a natural regulator of immunity and inflammation. Transplantation 2009, 88, 1–6. [Google Scholar] [CrossRef]
  53. Zachary, A.A.; Montgomery, R.A.; Ratner, L.E.; Samaniego-Picota, M.; Haas, M.; Kopchaliiska, D.; Leffell, M.S. Specific and durable elimination of antibody to donor HLA antigens in renal-transplant patients. Transplantation 2003, 76, 1519–1525. [Google Scholar] [CrossRef]
  54. Nair, V.; Sawinski, D.; Akalin, E.; Friedlander, R.; Ebcioglu, Z.; Sehgal, V.; Dinavahi, R.; Khaim, R.; Ames, S.; Lerner, S.; et al. Effect of high-dose intravenous immunoglobulin on anti-HLA Abs in sensitized kidney transplant candidates. Clin. Transplant. 2012, 26, E261–E268. [Google Scholar] [CrossRef]
  55. Alachkar, N.; Lonze, B.E.; Zachary, A.A.; Holechek, M.J.; Schillinger, K.; Cameron, A.M.; Desai, N.M.; Dagher, N.N.; Segev, D.L.; Montgomery, R.A.; et al. Infusion of high-dose intravenous immunoglobulin fails to lower the strength of human leukocyte antigen Abs in highly sensitized patients. Transplantation 2012, 94, 165–171. [Google Scholar] [CrossRef]
  56. Marfo, K.; Ling, M.; Bao, Y.; Calder, B.; Ye, B.; Hayde, N.; Greenstein, S.; Chapochnick-Friedman, J.; Glicklich, D.; De Boccardo, G.; et al. Lack of effect in desensitization with intravenous immunoglobulin and rituximab in highly sensitized patients. Transplantation 2012, 94, 345–351. [Google Scholar] [CrossRef]
  57. ELHilali, F.; Jucaud, V.; ELHilali, H.; Bhuiyan, M.H.; Mancuso, A.; LiuSullivan, N.; Elidrissi, A.; Mazouz, H. Characterization of the Anti-HLA Class I and II IgG Abs in Moroccan IVIg Using Regular Beads and Ibeads in Luminex Multiplex Single Antigen Immunoassay. Int. J. Immunol. 2017, 5, 53–65. [Google Scholar] [CrossRef] [Green Version]
  58. Ravindranath, M.H.; Terasaki, P.I.; Pham, T.; Jucaud, V.; Kawakita, S. Suppression of blastogenesis and proliferation of activated CD4(+) T-cells: Intravenous immunoglobulin (IVIg) versus novel anti-human leucocyte antigen (HLA)-E mAbs mimicking HLA-I reactivity of IVIg. Clin. Exp. Immunol. 2014, 178, 154–177. [Google Scholar] [CrossRef]
  59. Kaveri, S.; Vassilev, T.; Hurez, V.; Lengagne, R.; Lefranc, C.; Cot, S.; Pouletty, P.; Glotz, D.; Kazatchkine, M.D. Antibodies to a conserved region of HLA class I molecules, capable of modulating CD8 T cell-mediated function, are present in pooled normal immunoglobulin for therapeutic use. J. Clin. Investig. 1996, 97, 865–869. [Google Scholar] [CrossRef] [PubMed]
  60. Klaesson, S.; Ringdén, O.; Markling, L.; Remberger, M.; Lundkvist, I. Immune modulatory effects of immunoglobulns on cellmediated immune responses in vitro. Scand. J. Immunol. 1993, 38, 477–484. [Google Scholar] [CrossRef] [PubMed]
  61. Miyagi, F.; Horiuchi, H.; Nagata, I.S.; Kitahara, S.; Kiyoki, M.; Komoriya, K.; Yuki, N. Fc portion of intravenous immunoglobulins suppresses the induction of experimental allergic neuritis. J. Neuroimmunol. 1997, 78, 127–131. [Google Scholar] [CrossRef]
  62. Sali, A.D.; Karakasiliotis, I.; Evangelidou, M.; Avarameas, S.; Lymberi, P. Immunological evidence and regulatory potential for cell-penetrating antibodies in intravenous immunoglobulin. Clin. Transl. Immunol. 2015, 4, e42. [Google Scholar] [CrossRef] [PubMed]
  63. van Schaik, I.N.; Lundkvist, I.; Vermeulen, M.; Brand, A. Polyvalent immunoglobulin for intravenous use interferes with cell proliferation in vitro. J. Clin. Immunol. 1992, 12, 325–334. [Google Scholar] [CrossRef]
  64. Sbrana, S.; Ruocco, L.; Vanacore, R.; Azzarà, A.; Ambrogi, F. In vitro effects of an immunoglobulin preparation for intravenous use (IVIG) on T-cells activation. Allerg. Immunol. 1993, 25, 35–37. [Google Scholar]
  65. Hurez, V.; Kaveri, S.V.; Mouhoub, A.; Dietrich, G.; Mani, J.C.; Klatzmann, D.; Kazatchkine, M.D. Anti-CD4 activity of normal human immunoglobulin G for therapeutic use (intravenous immunoglobulin, IVIg). Ther. Immunol. 1994, 1, 269–277. [Google Scholar] [PubMed]
  66. Amran, D.; Renz, H.; Lack, G.; Bradley, K.; Gelfand, E.W. Suppression of cytokine-dependent human T-cell proliferation by intravenous immunoglobulin. Clin. Immunol. Immunopathol. 1994, 73, 180–186. [Google Scholar] [CrossRef]
  67. Andersson, J.; Skansén-Saphir, U.; Sparrelid, E.; Andersson, U. Intravenous immune globulin affects cytokine production in T lymphocytes and monocytes/macrophages. Clin. Exp. Immunol. 1996, 104 (Suppl. 1), 10–20. [Google Scholar] [CrossRef]
  68. Prasad, N.K.; Papoff, G.; Zeuner, A.; Bonnin, E.; Kazatchkine, M.D.; Ruberti, G.; Kaveri, S.V. Therapeutic preparations of normal polyspecific IgG (IVIg) induce apoptosis in human lymphocytes and monocytes: A novel mechanism of action of IVIg involving the Fas apoptotic pathway. J. Immunol. 1998, 161, 3781–3790. [Google Scholar] [PubMed]
  69. Aktas, O.; Waiczies, S.; Grieger, U.; Wendling, U.; Zschenderlein, R.; Zipp, F. Polyspecific immunoglobulins (IVIg) suppress proliferation of human (auto)antigen-specific T-cells without inducing apoptosis. J. Neuroimmunol. 2001, 114, 160–167. [Google Scholar] [CrossRef]
  70. MacMillan, H.F.; Lee, T.; Issekutz, A.C. Intravenous immunoglobulin G-mediated inhibition of T-cell proliferation reflects an endogenous mechanism by which IgG modulates T-cell activation. Clin. Immunol. 2009, 132, 222–233. [Google Scholar] [CrossRef] [PubMed]
  71. Aubin, E.; Lemieux, R.; Bazin, R. Indirect inhibition of in vivo and in vitro T-cell responses by intravenous immunoglobulins due to impaired antigen presentation. Blood 2010, 115, 1727–1734. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  72. Tawfik, D.S.; Cowan, K.R.; Walsh, A.M.; Hamilton, W.S.; Goldman, F.D. Exogenous immunoglobulin downregulates T-cell receptor signaling and cytokine production. Pediatr. Allergy Immunol. 2012, 23, 88–95. [Google Scholar] [CrossRef]
  73. Koffman, B.M.; Dalakas, M.C. Effect of high-dose intravenous immunoglobulin on serum chemistry, hematology, and lymphocyte subpopulations: Assessments based on controlled treatment trials in patients with neurological diseases. Muscle Nerve 1997, 20, 1102–1107. [Google Scholar] [CrossRef]
  74. Rodriguez, M.A.; De Sanctis, J.B.; Blasini, A.; Leon-Ponte, M.; Abadi, I. Human IFN-gamma up-regulates IL-2 receptors in mitogen-activated T lymphocytes. Immunology 1990, 69, 554–557. [Google Scholar]
  75. Santos, S.G.; Antoniou, A.N.; Sampaio, P.; Powis, S.J.; Arosa, F.A. Lack of tyrosine 320 impairs spontaneous endocytosis and enhances release of HLA-B27 molecules. J. Immunol. 2006, 176, 2942–2949. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  76. Guild, B.C.; Strominger, J.L. Human and murine class I MHC antigens share conserved serine 335, the site of HLA phosphorylation in vivo. J. Biol. Chem. 1984, 259, 9235–9240. [Google Scholar] [CrossRef]
  77. Mustelin, T.; Vang, T.; Bottini, T.N. Protein tyrosine phosphatases and the immune response. Nat. Rev. Immunol. 2005, 5, 43–57. [Google Scholar] [CrossRef] [PubMed]
  78. Buckley, R.H.; Schiff, R.I. The use of intravenous immune globulin in immuno-deficiency diseases. N. Engl. J. Med. 1991, 325, 110–117. [Google Scholar] [CrossRef] [PubMed]
  79. Kaveri, S.V.; Dietrich, G.; Hurez, V.; Kazatchkine, M.D. Intravenous immunoglobulins (IVIg) in the treatment of autoimmune diseases. Clin. Exp. Immunol. 1991, 86, 192–198. [Google Scholar] [CrossRef]
  80. McIntyre, J.A.; Higgins, N.; Britton, R.; Faucett, S.; Johnson, S.; Beckman, D.; Hormuth, D.; Fehrenbacher, J.; Halbrook, H. Utilization of intravenous immunoglobulin to ameliorate all-Abs in a highly sensitized patient with a cardiac assist device awaiting heart transplantation. Fluorescence-activated cell sorter analysis. Transplantation 1996, 62, 691–693. [Google Scholar] [CrossRef]
  81. Ippoliti, F.; De Santis, W.; Volterrani, A.; Canitano, N.; Frattolillo, D.; Lucarelli, S.; Frediani, S.; Frediani, T. Psychological stress affects response to sublingual immunotherapy in asthmatic children allergic to house dust mite. Pediatr. Allergy Immunol. 2006, 17, 337–345. [Google Scholar] [CrossRef]
  82. Glotz, D.; Antoine, C.; Julia, P.; Suberbielle-Boissel, C.; Boudjeltia, S.; Fraoui, R.; Hacen, C.; Duboust, A.; Bariety, J. Desensitization and subsequent kidney transplantation of patients using intravenous immunoglobulins (IVIg). Am. J. Transplant. 2002, 2, 758–760. [Google Scholar] [CrossRef]
  83. Sethi, S.; Choi, J.; Toyoda, M.; Vo, A.; Peng, A.; Jordan, S.C. Desensitization: Overcoming the Immunologic Barriers to Transplantation. J. Immunol. Res. 2017, 2017, 6804678. [Google Scholar] [CrossRef]
  84. Jordan, S.C.; Tyan, D.; Stablein, D.; McIntosh, M.; Rose, S.; Vo, A.; Toyoda, M.; Davis, C.; Shapiro, R.; Adey, D.; et al. Evaluation of intravenous immunoglobulin as an agent to lower allosensitization and improve transplantation in highly sensitized adult patients with end-stage renal disease: Report of the NIH IG02 trial. J. Am. Soc. Nephrol. 2004, 15, 3256–3262. [Google Scholar] [CrossRef]
  85. Ross, C.N.; Gaskin, G.I.; Gregor-Macgregor, S.U.; Patel, A.A.; Davey, N.J.; Lechler, R.I.; Williams, G.O.; Rees, A.J.; Pusey, C.D. Renal transplantation following immunoadsorption in highly sensitized recipients. Transplantation 1993, 5, 785–789. [Google Scholar] [CrossRef]
  86. larabi, A.; Backman, U.; Wikstrom, B.; Sjoberg, O.; Tufveson, G. Pretransplantation plasmapheresis in HLA-sensitized patients: Five years experience. Transplant. Proc. 1995, 27, 3448. [Google Scholar]
  87. Stegall, M.D.; Gloor, J.; Winters, J.L.; Moore, S.B.; Degoey, S. A comparison of plasmapheresis versus high-dose IVIG desensitization in renal allograft recipients with high levels of donor specific alloantib ody. Am. J. Transplant. 2006, 6, 346–351. [Google Scholar] [CrossRef]
  88. Onrust, S.V.; Lamb, H.M.; Balfour, J.A. Rituximab. Drugs 1999, 58, 79–88. [Google Scholar] [CrossRef] [PubMed]
  89. Vo, A.A.; Lukovsky, M.; Toyoda, M.; Wang, J.; Reinsmoen, N.L.; Lai, C.H.; Peng, A.; Villicana, R.; Jordan, S.C. Rituximab and intravenous immune globulin for desensitization during real transplantation. N. Engl. J. Med. 2008, 359, 242–251. [Google Scholar] [CrossRef] [Green Version]
  90. Vo, A.A.; Peng, A.; Toyoda, M.; Kahwaji, J.; Cao, K.; Lai, C.H.; Reinsmoen, N.L.; Villicana, R.; Jordan, S.C. Use of intravenous immune globulin and rituximab for desensitization of highly HLA-sensitized patients awaiting kidney transplantation. Transplantation 2010, 89, 1095–1102. [Google Scholar] [CrossRef] [Green Version]
  91. Vo, A.A.; Choi, J.; Cisneros, K.; Reinsmoen, N.; Haas, M.; Ge, S.; Toyoda, M.; Kahwaji, J.; Peng, A.; Villicana, R.; et al. Benefits of rituximab combine with intravenous immunoglobulin for desensitization of kidney transplant recipients. Transplantation 2014, 98, 312–319. [Google Scholar] [CrossRef]
  92. Zhu, D.; Ravindranath, M.H.; Terasaki, P.I.; Miyazaki, T.; Pham, T.; Jucaud, V. Suppression of allo-human leucocyteantigen (HLA) Abs secreted by B memory cells in vitro: Intravenous immunoglobulin (IVIg) versus a monoclonal anti-HLA-E IgG that mimics HLA-I reactivities of IVIg. Clin. Exp. Immunol. 2014, 177, 464–477. [Google Scholar] [CrossRef]
  93. Baecher-Allan, C.; Brown, J.A.; Freeman, G.J.; Hafler, D.A. CD4+CD25+ high regulatory cells in human peripheral blood. J. Immunol. 2001, 167, 1245–1253. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  94. Ng, W.F.; Duggan, P.J.; Ponchel, F.; Matarese, G.; Lombardi, G.; Edwards, A.D.; Isaacs, J.D.; Lechler, R.I. Human CD4+CD25+ cells: A naturally occurring population of regulatory T-cells. Blood 2001, 98, 2736–2744. [Google Scholar] [CrossRef]
  95. Li, Y.; Koshiba, T.; Yoshizawa, A.; Yonekawa, Y.; Masuda, K.; Ito, A.; Ueda, M.; Mori, T.; Kawamoto, H.; Tanaka, Y.; et al. Analyses of peripheral blood mononuclear cells in operational tolerance after pediatric living donor liver Transplantation. Am. J. Transplant. 2004, 4, 2118–2125. [Google Scholar] [CrossRef] [Green Version]
  96. Pons, J.A.; Revilla-Nuin, B.; Baroja-Mazo, A.; Ramírez, P.; Martínez-Alarcón, L.; Sánchez-Bueno, F.; Robles, R.; Rios, A.; Aparicio, P.; Parrilla, P. FoxP3 in peripheral blood is associated with operational tolerance in liver transplant patients during immunosuppression withdrawal. Transplantation 2008, 86, 1370–1378. [Google Scholar] [CrossRef]
  97. Baroja-Mazo, A.; Revilla-Nuin, B.; Parrilla, P.; Martinez-Alarcon, L.; Ramirez, P.; Pons, J.A. Tolerance in liver Transplantation: Biomarkers and clinical relevance. World J. Gastroenterol. 2016, 22, 7676–7691. [Google Scholar] [CrossRef] [PubMed]
  98. Baroja-Mazo, A.; Revilla-Nuin, B.; de Bejar, Á.; Martínez-Alarcón, L.; Herrero, J.I.; El-Tayeb, A.; Müller, C.E.; Aparicio, P.; Pelegrín, P.; Pons, J.A. Extracellular adenosine reversibly inhibits the activation of human regulatory T-cells and negatively influences the achievement of the operational tolerance in liver Transplantation. Am. J. Transplant. 2019, 9, 48–61. [Google Scholar] [CrossRef] [Green Version]
  99. Jhun, J.; Lee, S.H.; Lee, S.K.; Kim, H.Y.; Jung, E.S.; Kim, D.G.; Choi, J.; Bae, S.H.; Yoon, S.K.; Chung, B.H.; et al. Serial monitoring of immune markers being represented regulatory T cell/T helper 17 cell ratio: Indicating tolerance for tapering immunosuppression after liver Transplantation. Front. Immunol. 2018, 9, 352. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  100. Sablik, K.A.; Jordanova, E.S.; Pocorni, N.; Clahsen-van Groningen, M.C.; Betjes, M.G.H. Immune Cell Infiltrate in Chronic-Active Antibody-Mediated Rejection. Front. Immunol. 2019, 10, 3106. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  101. Dai, H.; Zheng, Y.; Thomson, A.W.; Rogers, N.M. Transplant Tolerance Induction: Insights from the Liver. Front. Immunol. 2020, 11, 1044. [Google Scholar] [CrossRef] [PubMed]
  102. Hara, M.; Kingsley, C.I.; Niimi, M.; Read, S.; Turvey, S.E.; Bushell, A.R.; Morris, P.J.; Powrie, F.; Wood, K.J. IL-10 is required for regulatory T-cells to mediate tolerance to alloantigens in vivo. J. Immunol. 2001, 166, 3789–3796. [Google Scholar] [CrossRef] [PubMed]
  103. Levings, M.; Sangregorio, R.; Roncarolo, M.G. Human CD25+CD4+ T regulatory cells suppress naive and memory T-cell proliferation and can be expanded in vitro without loss of function. J. Exp. Med. 2001, 193, 1295–1301. [Google Scholar] [CrossRef]
  104. van Maurik, K.; Wood, J.; Jones, N. Cutting edge: CD4+CD25+ alloantigen-specific immunoregulatory cells that can prevent CD8+ T-cell-mediated graft rejection: Implications for anti-CD154 immunotherapy. J. Immunol. 2002, 169, 5401–5404. [Google Scholar] [CrossRef] [Green Version]
  105. Lin, C.-Y.; Graca, L.; Cobbold, S.P.; Waldmann, H. Dominant transplantation tolerance impairs CD8+ T-cell function but not expansion. Nat. Immunol. 2002, 3, 1208–1213. [Google Scholar] [CrossRef]
  106. Graca, L.; Cobbold, S.P.; Waldmann, H. Identification of regulatory T-cells in tolerated allografts. J. Exp. Med. 2002, 195, 1641–1646. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  107. Cobbold, S.P.; Waldmann, H. Regulatory cells and transplantation tolerance. Cold Spring Harb. Perspect. Med. 2013, 3, a015545. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  108. Kikuchi, J.; Hashizume, M.; Kaneko, Y.; Yoshimoto, K.; Nishina, N.; Takeuchi, T. Peripheral blood CD4(+) CD25(+) CD127 (low) regulatory T-cells are significantly increased by tocilizumab treatment in patients with rheumatoid arthritis: Increase in regulatory T-cells correlates with clinical response. Arthritis Res. Ther. 2015, 17, 1–10. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  109. Ephrem, A.; Chamat, S.; Miquel, C.; Fisson, S.; Mouthon, L.; Caligiuri, G.; Delignat, S.; Elluru, S.; Bayry, J.; Lacroix-Desmazes, S.; et al. Expansion of CD4+CD25+regulatory T-cells by intravenous immunoglobulin: A critical factor in controlling experimental autoimmune encephalomyelitis. Blood 2008, 111, 715–722. [Google Scholar] [CrossRef] [PubMed]
  110. Filippone, E.J.; Das, B.; Norin, A.J.; Ravindranath, M.H. Optimizing the assessment of pathogenic anti-HLA antibodies. Am. J. Transplant. 2021, 21, 431–432. [Google Scholar] [CrossRef]
  111. Arosa, F.A.; Esgalhado, A.J.; Padrão, C.A.; Cardoso, E.M. Divide, Conquer, and Sense: CD8+CD28- T-cells in Perspective. Front. Immunol. 2017, 7, 665. [Google Scholar] [CrossRef] [Green Version]
  112. Arosa, F.A.; de Jesus, O.; Porto, G.; Carmo, A.M.; de Sousa, M. Calreticulin is expressed on the cell surface of activated human peripheral blood T lymphocytes in association with major histocompatibility complex class I molecules. J. Biol. Chem. 1999, 274, 16917–16922. [Google Scholar] [CrossRef] [Green Version]
  113. Allen, R.L.; Trowsdale, J. Recognition of classical and heavy chain forms of HLA-B27 by leukocyte receptors. Curr. Mol. Med. 2004, 4, 59–65. [Google Scholar] [CrossRef]
  114. Jones, D.C.; Kosmoliaptsis, V.; Apps, R.; Lapaque, N.; Smith, I.; Kono, A.; Chang, C.; Boyle, L.H.; Taylor, C.J.; Trowsdale, J.; et al. HLA class I allelic sequence and conformation regulate leukocyte Ig-like receptor binding. J. Immunol. 2011, 186, 2990–2997. [Google Scholar] [CrossRef] [Green Version]
  115. Tamir, I.; Cambier, J.C. Antigen receptor signaling: Integration of protein tyrosine kinase functions. Oncogene 1988, 17, 1353–1364. [Google Scholar] [CrossRef] [PubMed]
  116. Angulo, R.; Fulcher, D.A. Measurement of Candida-specific blastogenesis: Comparison of carboxyfluorescein succinimidyl ester labelling of T-cells, thymidine incorporation, and CD69 expression. Cytometry 1998, 34, 143–151. [Google Scholar] [CrossRef]
Figure 1. HLA-E structure shows specific amino acid sequences, private epitopes, shared amino acid sequences, or public epitopes. (A). Private epitopes recognized by the anti-HLA-E monospecific mAb, TFL-033 (B). Public epitopes are recognized by the anti-HLA-E mAbs, TFL-006, and TFL-007. Both private and public epitopes are shown in yellow.
Figure 1. HLA-E structure shows specific amino acid sequences, private epitopes, shared amino acid sequences, or public epitopes. (A). Private epitopes recognized by the anti-HLA-E monospecific mAb, TFL-033 (B). Public epitopes are recognized by the anti-HLA-E mAbs, TFL-006, and TFL-007. Both private and public epitopes are shown in yellow.
Vaccines 09 00680 g001
Figure 2. Diagrammatic illustration of six isoforms of HLA class I molecules. The upper row shows the structures of intact, trimeric, closed conformers (CCs) of HLA. Note the shortened cytoplasmic tail. The lower row shows monomeric HLA-I (open conforms OCs). OCs of HLA-I expose epitopes masked by β2m. These epitopes, particularly 117AYDGKDY123 and 126LNEDLRSWTA135, are found in almost all alleles of the six isoforms of HLA.
Figure 2. Diagrammatic illustration of six isoforms of HLA class I molecules. The upper row shows the structures of intact, trimeric, closed conformers (CCs) of HLA. Note the shortened cytoplasmic tail. The lower row shows monomeric HLA-I (open conforms OCs). OCs of HLA-I expose epitopes masked by β2m. These epitopes, particularly 117AYDGKDY123 and 126LNEDLRSWTA135, are found in almost all alleles of the six isoforms of HLA.
Vaccines 09 00680 g002
Figure 3. Shedding of membrane-bound CC and the shedding results in dissociation of HLA α-HC from β2m. The membrane-bound α-HC is cleaved by a Zn2+-dependent membrane metalloproteinase. The shed α-HC and β2m are further degraded. Immune recognition of shed β2m and α-HC can occur at any time [29,30].
Figure 3. Shedding of membrane-bound CC and the shedding results in dissociation of HLA α-HC from β2m. The membrane-bound α-HC is cleaved by a Zn2+-dependent membrane metalloproteinase. The shed α-HC and β2m are further degraded. Immune recognition of shed β2m and α-HC can occur at any time [29,30].
Vaccines 09 00680 g003
Figure 4. Three different kinds of microbeads used: Regular beads admixed with CCs and OCs; The acid or alkali treated regular beads with OC only, (iii) beads restricted with CC. The microbeads were characterized using W6/32 (IgG2a) bound to peptide-associated and peptide-free CCs, but not bound to the OCs. HC-10 (IgG2a) recognized CCs devoid of a peptide. HLA-I polyreactive mAb TFL-006 (IgG2a) bound to OCs only and was inhibited by the shared peptides (117AYDGKDY123 and 126LNEDLRSWTA135) found in all HLA-I isoforms.
Figure 4. Three different kinds of microbeads used: Regular beads admixed with CCs and OCs; The acid or alkali treated regular beads with OC only, (iii) beads restricted with CC. The microbeads were characterized using W6/32 (IgG2a) bound to peptide-associated and peptide-free CCs, but not bound to the OCs. HC-10 (IgG2a) recognized CCs devoid of a peptide. HLA-I polyreactive mAb TFL-006 (IgG2a) bound to OCs only and was inhibited by the shared peptides (117AYDGKDY123 and 126LNEDLRSWTA135) found in all HLA-I isoforms.
Vaccines 09 00680 g004
Figure 5. HLA-I polyreactivity of IVIg. IVIg was tested on three kinds of SABs: (i) regular LABScreen bead set coated with an admixture of CCs and OCs, (ii) regular LABScreen bead set treated with a mild acid to convert OCs to CCs. The bead set was loaded with OCs. (iii) “iBeads” generated from regular LABScreen bead sets to enzymatically eliminate OCs, and therefore containing only CCs. The Luminex immunoassay with IVIg from GammaSTAN (A) and Octagam (B) confirmed the HLA-I polyreactivity of IVIg. Importantly, IVIG reacted with the monomeric variants on the acid-denatured SABs better than on iBeads. The density of IgG binding is illustrated by mean fluorescent intensity (MFI), as shown in different colors. The binding affinity of IVIg to monomeric variants was much higher than those recognizing the CC on ‘iBeads.’.
Figure 5. HLA-I polyreactivity of IVIg. IVIg was tested on three kinds of SABs: (i) regular LABScreen bead set coated with an admixture of CCs and OCs, (ii) regular LABScreen bead set treated with a mild acid to convert OCs to CCs. The bead set was loaded with OCs. (iii) “iBeads” generated from regular LABScreen bead sets to enzymatically eliminate OCs, and therefore containing only CCs. The Luminex immunoassay with IVIg from GammaSTAN (A) and Octagam (B) confirmed the HLA-I polyreactivity of IVIg. Importantly, IVIG reacted with the monomeric variants on the acid-denatured SABs better than on iBeads. The density of IgG binding is illustrated by mean fluorescent intensity (MFI), as shown in different colors. The binding affinity of IVIg to monomeric variants was much higher than those recognizing the CC on ‘iBeads.’.
Vaccines 09 00680 g005aVaccines 09 00680 g005b
Figure 6. (A). The proliferation assay is based on labeling the purified T-cells during PHA activation with the intracellular fluorescent dye carboxyfluorescein succinimidyl ester (CFSE: C25H15NO9; mol. mass: 473.39 g/mol) and using flow cytometry, measuring mitotic activity by the successive twofold reductions in fluorescent intensity of the T-cells placed in culture for 72 h. CFSE is cell-permeable and is retained for long periods within cells by covalently coupling by means of its succinimidyl group to intracellular molecules. Due to this stable linkage, once incorporated within cells, CFSE is not transferred to adjacent T-cells but remains in the cell even after several mitotic divisions. (B). Suppression of blastogenesis and proliferation of CD4+ T-cells by IVIg (Globex) and HLA-I polyreactive mAb TFL-007 at similar protein concentrations. The CFSC profile illustrates suppression as indicated by asterisks.
Figure 6. (A). The proliferation assay is based on labeling the purified T-cells during PHA activation with the intracellular fluorescent dye carboxyfluorescein succinimidyl ester (CFSE: C25H15NO9; mol. mass: 473.39 g/mol) and using flow cytometry, measuring mitotic activity by the successive twofold reductions in fluorescent intensity of the T-cells placed in culture for 72 h. CFSE is cell-permeable and is retained for long periods within cells by covalently coupling by means of its succinimidyl group to intracellular molecules. Due to this stable linkage, once incorporated within cells, CFSE is not transferred to adjacent T-cells but remains in the cell even after several mitotic divisions. (B). Suppression of blastogenesis and proliferation of CD4+ T-cells by IVIg (Globex) and HLA-I polyreactive mAb TFL-007 at similar protein concentrations. The CFSC profile illustrates suppression as indicated by asterisks.
Vaccines 09 00680 g006
Figure 7. Suppression of PHA-activated CD4+ T-cells by HLA polyreactive monoclonals TFL-006 and TFL-007 at 1/10 dilutions. The control mAb, TFL-037, failed to suppress PHA-activated proliferation, whereas the HLA-I polyreactive mAbs suppressed proliferation significantly. Dosimetric suppression of TFL-007 is shown.
Figure 7. Suppression of PHA-activated CD4+ T-cells by HLA polyreactive monoclonals TFL-006 and TFL-007 at 1/10 dilutions. The control mAb, TFL-037, failed to suppress PHA-activated proliferation, whereas the HLA-I polyreactive mAbs suppressed proliferation significantly. Dosimetric suppression of TFL-007 is shown.
Vaccines 09 00680 g007
Figure 8. Suppression of proliferation of PHA-activated CD4+ T-cells by purified culture supernatant of anti-HLA-E mAb TFL-006s. Results of the triplicate analysis are presented. The numbers inside refer to cell counts. Refer to Figure 5A to understand the meaning of the shift in the profiles from right to left.
Figure 8. Suppression of proliferation of PHA-activated CD4+ T-cells by purified culture supernatant of anti-HLA-E mAb TFL-006s. Results of the triplicate analysis are presented. The numbers inside refer to cell counts. Refer to Figure 5A to understand the meaning of the shift in the profiles from right to left.
Vaccines 09 00680 g008
Figure 9. A model illustrating the possible mechanism underlying phytohemagglutinin (PHA) activation of T-cells and the suppression of activated T-cells mediated by HLA-I polyreactive mAbs (TFL-006 and TLF-007) and possibly by IVIg. The model is based on a model proposed by Mustelin, Vang, and Bottini [77] for T-cell activation. The CD3/T-cell receptor (TCR)/CD4 structure on the lipid raft (pink zone) of the bi-layered lipid membrane on the non-phosphorylated, non-activated CD4+ T-cells is illustrated. The lymphocyte-specific protein, tyrosine kinase (LCK), induced phosphorylation of tyrosine-based activation in the cytoplasmic domain of CD3, which led to the activation of transcription factors and the transcription of cell surface molecules such as interleukin (IL)-2Rα and open conformers of HLA class I. SH-1, SH-2, and SH-3 represent family members of Src homology; they are involved in mediating the cytoplasmic domain of CD3. Further activation of the tyrosyl-phosphorylated motifs and then interaction with SH-1 domains within the protein kinase LCK led to further signaling function [77]. Importantly, the exposure of shared amino acid sequences of all the HLA open conformers is indicated by a blue circle. It is this site that is recognized by TFL-006 and TFL-007. Possible interactions and consequences of recognition of the shared peptide sequences by the HLA-I polyreactive IgG mAbs are illustrated in three steps: first, the exposure of the shared peptide sequence on the open conformer; secondly, recognition of the shared epitopes on the open conformer by the mAbs; thirdly, possible phosphorylation of the elongated cytoplasmic tail of open conformers. That elongation resulted in the exposure of cryptic tyrosine (Tyr320) and serine (Ser355) residues in the cytoplasmic tail. It might have been the binding of the mAbs to the shared peptide sequences that initiated the phosphorylation, leading to signal transduction. A final step involved initiation of dephosphorylation of the cytoplasmic domain of CD3, resulting in arrest of activation or suppression. That seemed plausible, as the phosphorylation was known to be reversible.
Figure 9. A model illustrating the possible mechanism underlying phytohemagglutinin (PHA) activation of T-cells and the suppression of activated T-cells mediated by HLA-I polyreactive mAbs (TFL-006 and TLF-007) and possibly by IVIg. The model is based on a model proposed by Mustelin, Vang, and Bottini [77] for T-cell activation. The CD3/T-cell receptor (TCR)/CD4 structure on the lipid raft (pink zone) of the bi-layered lipid membrane on the non-phosphorylated, non-activated CD4+ T-cells is illustrated. The lymphocyte-specific protein, tyrosine kinase (LCK), induced phosphorylation of tyrosine-based activation in the cytoplasmic domain of CD3, which led to the activation of transcription factors and the transcription of cell surface molecules such as interleukin (IL)-2Rα and open conformers of HLA class I. SH-1, SH-2, and SH-3 represent family members of Src homology; they are involved in mediating the cytoplasmic domain of CD3. Further activation of the tyrosyl-phosphorylated motifs and then interaction with SH-1 domains within the protein kinase LCK led to further signaling function [77]. Importantly, the exposure of shared amino acid sequences of all the HLA open conformers is indicated by a blue circle. It is this site that is recognized by TFL-006 and TFL-007. Possible interactions and consequences of recognition of the shared peptide sequences by the HLA-I polyreactive IgG mAbs are illustrated in three steps: first, the exposure of the shared peptide sequence on the open conformer; secondly, recognition of the shared epitopes on the open conformer by the mAbs; thirdly, possible phosphorylation of the elongated cytoplasmic tail of open conformers. That elongation resulted in the exposure of cryptic tyrosine (Tyr320) and serine (Ser355) residues in the cytoplasmic tail. It might have been the binding of the mAbs to the shared peptide sequences that initiated the phosphorylation, leading to signal transduction. A final step involved initiation of dephosphorylation of the cytoplasmic domain of CD3, resulting in arrest of activation or suppression. That seemed plausible, as the phosphorylation was known to be reversible.
Vaccines 09 00680 g009
Figure 10. The impact of IVIg (GamaSTAN) and HLA-I polyreactive mAb (TFL-007) on the primary alloantibody DRB1*0101 (IgG), secreted by activated B-lymphocytes obtained from an alloimmunized woman. GamaSTAN S/D IVIg was used at 1:100 dilution, 1.5 mg. protein/mL. At the time when the IVIg was added, the cytokine combo and anti-CD40 antibody were not added. In all panels, the mean fluorescent intensity (MFI) of alloantibody secretion is compared between the medium control and treatment with IVIg and HLA-I polyreactive IgG2a mAb TFL-007. IVIg inhibited the secretion of the primary alloantibody at a significant level (p2 = 0.01). HLA-I polyreactive mAb inhibited the secretion of the primary alloantibody at a higher significant level (p2 = 0.0005). This is an original figure.
Figure 10. The impact of IVIg (GamaSTAN) and HLA-I polyreactive mAb (TFL-007) on the primary alloantibody DRB1*0101 (IgG), secreted by activated B-lymphocytes obtained from an alloimmunized woman. GamaSTAN S/D IVIg was used at 1:100 dilution, 1.5 mg. protein/mL. At the time when the IVIg was added, the cytokine combo and anti-CD40 antibody were not added. In all panels, the mean fluorescent intensity (MFI) of alloantibody secretion is compared between the medium control and treatment with IVIg and HLA-I polyreactive IgG2a mAb TFL-007. IVIg inhibited the secretion of the primary alloantibody at a significant level (p2 = 0.01). HLA-I polyreactive mAb inhibited the secretion of the primary alloantibody at a higher significant level (p2 = 0.0005). This is an original figure.
Vaccines 09 00680 g010
Figure 11. Effects of different commercial preparations of IVIg, which included GamaSTAN™ S/D (15–18 gm%, Lot 26NHCVI; (Talecris Biotherapeutics, Inc., Research Triangle Park, NC, USA) at dilutions 1/10 (concentration 15 mg/mL) and 1/80 (concentration 1.2 mg/mL), octagam® (6 gm%, Lot A913A8431; Octapharma Pharmazeutika) at dilutions 1/20 (concentration 3 mg/mL) and 1/80 (concentration 0.75 mg/mL), Gamunex®-C (10 gm%, Lots 26NKLG1 and 26NKLK1; Telacris) at dilutions 1/10 (concentration 10 mg/mL) and 1/80 (concentration 8 mg/mL), and mAb TFL-007a (at dilution 1/10, concentration 62.7 μg/mL; 1/80, concentration 7.84 μg/mL) on PHA-untreated cells were compared with the effect of medium alone on the proliferation of Treg cells, defined as CD4+/CD25+/Foxp3+. Note that IVIg preparations used in this study failed to upregulate Tregs, in contrast to TFL-007a, which significantly upregulated Treg cells at dilution 1/10. This figure is original but derived and modified from a previous report [48].
Figure 11. Effects of different commercial preparations of IVIg, which included GamaSTAN™ S/D (15–18 gm%, Lot 26NHCVI; (Talecris Biotherapeutics, Inc., Research Triangle Park, NC, USA) at dilutions 1/10 (concentration 15 mg/mL) and 1/80 (concentration 1.2 mg/mL), octagam® (6 gm%, Lot A913A8431; Octapharma Pharmazeutika) at dilutions 1/20 (concentration 3 mg/mL) and 1/80 (concentration 0.75 mg/mL), Gamunex®-C (10 gm%, Lots 26NKLG1 and 26NKLK1; Telacris) at dilutions 1/10 (concentration 10 mg/mL) and 1/80 (concentration 8 mg/mL), and mAb TFL-007a (at dilution 1/10, concentration 62.7 μg/mL; 1/80, concentration 7.84 μg/mL) on PHA-untreated cells were compared with the effect of medium alone on the proliferation of Treg cells, defined as CD4+/CD25+/Foxp3+. Note that IVIg preparations used in this study failed to upregulate Tregs, in contrast to TFL-007a, which significantly upregulated Treg cells at dilution 1/10. This figure is original but derived and modified from a previous report [48].
Vaccines 09 00680 g011
Table 1. Amino acid sequences of HLA-E compared with HLA-F and HLA-G. There are several sequences restricted to HLA-E, as illustrated by a short sequence, 66SARDT70, and a long sequence, 143SEGKSNDASE152. HLA-E shares several sequences with HLA-F and HLA-G. In addition, HLA-E may selectively share several sequences with HLA-G and a few sequences (175GKETL179 and 193PISDH197) with HLA-F. Above all, HLA-E shares 117AYDGKDY123 and 126LNEDLRSWTA135 with all other HLA isoforms (HLA-A, HLA-B, HLA-C, HLA-F, and HLA-G).
Table 1. Amino acid sequences of HLA-E compared with HLA-F and HLA-G. There are several sequences restricted to HLA-E, as illustrated by a short sequence, 66SARDT70, and a long sequence, 143SEGKSNDASE152. HLA-E shares several sequences with HLA-F and HLA-G. In addition, HLA-E may selectively share several sequences with HLA-G and a few sequences (175GKETL179 and 193PISDH197) with HLA-F. Above all, HLA-E shares 117AYDGKDY123 and 126LNEDLRSWTA135 with all other HLA isoforms (HLA-A, HLA-B, HLA-C, HLA-F, and HLA-G).
1234567891011121314151617181920212223242526272829303132333435363738394041424344454647484950
HLA-EGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAP
HLA-GGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAP
HLA-FGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREP
a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1a1
51525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899100
HLA-EWMEQEGSEYWDRETRSARDTAQLFRVNLRTLRGYYNQSEAGSHTLQWMHG
HLA-GWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIG
HLA-FWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNG
a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2
101102103104105106107108109110111112113114115116117118119120121122123124125126127128129130131132133134135136137138139140141142143144145146147148149150
HLA-ECELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEGKSNDA
HLA-GCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAA
HLA-FCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAE
SHARED WITH HLA-A/-B & -C SHARED WITH HLA-A, HLA-B & HLA-C
a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2a2
151152153154155156157158159160161162163164165166167168169170171172173174175176177178179180181182183184185186187188189190191192193194195196197198199200
HLA-ESEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEAT
HLA-GNVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEAT
HLA-FEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEAT
201202203204205206207208209210211212213214215216217218219220221222223224225226227228229230231232233234235236237238239240241242243244245246247248249250
HLA-ELRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVP
HLA-GLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVP
HLA-FLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVP
Table 2. Comparison of the amino acid sequence of HLA-E with sequences of five other HLA isoforms. Several peptide sequences of HLA-E are shared with the alleles of other HLA-I isoforms. Note that amino acid sequence AYDGKDY is shared with the maximum number of alleles of all isoforms of HLA-I, while sequences PRAPWMEQE and EPPKTHVT are shared with one allele of HLA-A (A*3306) and one allele of HLA-B (B*8201). The bioinformatics analysis was carried out using the Immune Epitope Database (IEDB) to predict the antigenicity rank of epitopes. The Chou and Fasman beta turn, Kolaskar and Tongaonkar antigenicity, Karplus and Schulz flexibility, and Parker hydrophilicity prediction methods in IEDB were employed. The methods predict the probability of specific sequences in HLA-E that bind to Abs being in a beta turn region, being antigenic, being flexible, or being in a hydrophilic region. Antigenicity rank is calculated by pooling the probability values.
Table 2. Comparison of the amino acid sequence of HLA-E with sequences of five other HLA isoforms. Several peptide sequences of HLA-E are shared with the alleles of other HLA-I isoforms. Note that amino acid sequence AYDGKDY is shared with the maximum number of alleles of all isoforms of HLA-I, while sequences PRAPWMEQE and EPPKTHVT are shared with one allele of HLA-A (A*3306) and one allele of HLA-B (B*8201). The bioinformatics analysis was carried out using the Immune Epitope Database (IEDB) to predict the antigenicity rank of epitopes. The Chou and Fasman beta turn, Kolaskar and Tongaonkar antigenicity, Karplus and Schulz flexibility, and Parker hydrophilicity prediction methods in IEDB were employed. The methods predict the probability of specific sequences in HLA-E that bind to Abs being in a beta turn region, being antigenic, being flexible, or being in a hydrophilic region. Antigenicity rank is calculated by pooling the probability values.
HLA-E Peptide SequencesHLA Alleles Method 1Method 2Method 3Method 4Rank of Antigenicity
Prediction SCORES
Classical HLA-Ib Non-Classical HLA-IbSpecificityBeta-Turn AntigenicityFlexibility Hydrophilicity
[total number of amino acids]ABCwFG Chou & Fasman (1978)Kolaskar & Tangaonkar (1990)Karplus & Schulz (1985)Parker (1986)
47PRAPWMEQE55 [9]10000A*33060.9930.9480.9690.586/1.143/1.657
58EYWDRETR65 [8]50000A restricted0.9930.9151.0243.301/2.78610
90AGSHTLQW97 [8]1104800Polyspecific1.0191.0330.9892.629/0.9016
108RFLRGYE114 [7]240000A restricted0.9330.9960.9960.2298
115QFAYDGKDY123 [9]11047500Polyspecific1.0591.0010.9932.629/3.2015
117AYDGKDY123 [7]4918312712130Polyspecific1.2040.9891.0614.2431
126LNEDLRSWTA135 [10]2392192612130Polyspecific1.0460.9831.0392.443/2.3292
137DTAAQI142 [6]0824248030Polyspecific0.8131.0650.9781.9573
137DTAAQIS143 [7] 0524030Polyspecific0.9461.0120.973.4147
157RAYLED162 [6]01000B*82010.9290.9960.9692.601
163TCVEWL168 [6]282206200030Polyspecific0.8411.1150.929−0.9144
183EPPKTHVT190 [8]001900C restricted1.0291.0441.0423.0439
65RSARDTA71 [7] 00000E restricted1.0110.9521.0384.9012
143SEQKSNDASE152 [10]00000E restricted1.2310.9231.2227.071/6.443/6.257/6.5141
Method 1. Predict beta turns in protein secondary structures. Chou PY, Fasman GD. Prediction of the secondary structure of proteins from their amino acid sequence. Adv Enzymol Relat Areas Mol Biol. 1978;47:45-148. DOI: 10.1002/9780470122921.ch2. Method 2. A semi-empirical method which made use of the physicochemical properties of amino acid residues and their frequencies of occurrence in experimentally known segmental epitopes was developed to predict antigenic determinants on proteins. Application of this method to a large number of proteins has shown that the method can predict antigenic determinants with about 75% accuracy, which is better than most of the known methods. Kolaskar AS, Tongaonkar PC. A semi-empirical method for prediction of antigenic determinants on protein antigens. FEBS Lett. 1990 Dec 10;276(1-2):172-4. doi: 10.1016/0014-5793(90)80535-q. Method 3. In this method, a flexibility scale, based on the mobility of protein segments on the basis of the known temperature B factors of the a-carbons of 31 proteins of known structure, was constructed. The calculation based on a flexibility scale is similar to classical calculation, except that the center is the first amino acid of the six amino acids’ window length, and there are three scales for describing flexibility instead of a single one. Karplus PA, Schulz GE. Prediction of Chain Flexibility in Proteins—A tool for the Selection of Peptide Antigens. Naturwissenschafren 1985; 72:212-3. Method 4. In this method, a hydrophilic scale based on peptide retention times during high-performance liquid chromatography (HPLC) on a reversed-phase column was constructed. A window of seven residues was used for analyzing epitope region. The corresponding value of the scale was introduced for each of the seven residues and the arithmetical mean of the seven residue values was assigned to the fourth, (i+3), residue in the segment. Parker JM, Guo D, Hodges RS. New hydrophilicity scale derived from high-performance liquid chromatography peptide retention data: correlation of predicted surface residues with antigenicity and X-ray-derived accessible sites. Biochemistry. 1986 Sep 23; 25(19):5425-32.
Table 3. The HLA-1 signatures of the mAbs generated after immunizing recombinant heavy chains of HLA-E. Group 10 is truly befitting the definition of a polyreactive mAb category.
Table 3. The HLA-1 signatures of the mAbs generated after immunizing recombinant heavy chains of HLA-E. Group 10 is truly befitting the definition of a polyreactive mAb category.
IMMUNOGEN HLA-ER107 OR HLA-EG107
GroupsNumberHLA-CLASS IbHLA-CLASS IC
of mAbsof mAbsHLA-EHLA-FHLA-GHLA-AHLA-BHLA-C
Group 124+
Group 21++
Group 31++
Group 48+++
Group 54++
Group 631+++
Group 7109++++
Group 811+++++
Group 918+++++
Group 107++++++
Table 4. HLA-I allele reactivities of the polyreactive mAbs as compared with monospecific mAbs. The values represent mean fluorescent intensities (MFIs) of the mAbs, corrected against background values. The mAbs were generated using HLA-E-recombinant heavy chains. The number of HLA antigens showing positive reactivity with the mAbs are shown in bold letters.
Table 4. HLA-I allele reactivities of the polyreactive mAbs as compared with monospecific mAbs. The values represent mean fluorescent intensities (MFIs) of the mAbs, corrected against background values. The mAbs were generated using HLA-E-recombinant heavy chains. The number of HLA antigens showing positive reactivity with the mAbs are shown in bold letters.
mAbsMonospecificPolyreactivemAbsMonospecificPolyreactivemAbsMonospecificPolyreactive
TFL-033TFL-006TFL-007 TFL-033TFL-006TFL-007 TFL-033TFL-006TFL-007
IgG1IgG2aIgG2a IgG1IgG2aIgG2a IgG1IgG2aIgG2a
Neg3157B* allelesC* alleles
Pos718885B*0702 1331841C*0102 72423268
HLA-E244112252221618B*0801 20921033C*0202 106906084
HLA-F 1265011035B*1301 56543979C*0302 59173062
HLA-G 71932670B*1302 22371426C*0303 71144250
A* allelesB*1401 113198767C*0304 65843891
A*0101 23951037B*1402 44142558C*0401 28431272
A*0201 856 B*1501 1097 C*0501 1613113096
A*0203 1095 B*1502 62564497C*0602 93964274
A*0206 1494843B*1503 28311926C*0702 122516919
A*0301 818 B*1510 26161470C*0801 1345610733
A*1101 101908476B*1511 90415902C*1203 50552102
A*1102 860 B*1512 1624996C*1402 87274936
A*2301 614 B*1513 53263365C*1502 60303225
A*2402 31332011B*1516 56143443C*1601 84624364
A*2403 31511967B*1801 69904890C*1701 135219069
A*2501 1230692B*2705 25911576C*1802 1791815207
A*2601 33681638B*2708 44372671C* alleles01616
A*2901 31942256B*3501 102058594
A*2902 22351136B*3701 64724338
A*3001 22291237B*3801 38441820
A*3002 33532211B*3901 70935304
A*3101 858 B*4001 57433758
A*3201 22371508B*4002 61184675
A*3301 27911627B*4006 1564313758
A*3303 42122961B*4101 71915277
A*3401 62683968B*4201 636
A*3402 1399893B*4402 70624059
A*3601 58063826B*4403 72565638
A*4301 44202364B*4501 95357646
A*6601 36441526B*4601 64914130
A*6602 1395789B*4701 65283895
A*6801 1314859B*4801 43652716
A*6802 20781276B*4901
A*6901 1964917B*5001 741
A*7401 723 B*5101 62053724
A*8001 28411430B*5102 52513579
A* alleles03224B*5201 45242728
B*5301 88077323
B*5401 55564153
B*5501 28291887
B*5601 1386777
B*5701
B*5703 1229600
B*5801 101608047
B*5901 56463001
B*6701 675
B*7301 33472171
B*7801 60894597
B*8101 1352729
B*8201 43673069
B* alleles04844
Table 5. Evidence showed that HLA-I polyreactive mAb TFL-006 bound to OCs (β2m-free αHLA HC) but not to CCs (β2m-associated HLA heavy chains or intact HLA molecules). TFL-006 bound only with LABScreen SABs (contained both open and CCs) but not with LIFECODES, which had only CCs, as established in previous reports [45,47].
Table 5. Evidence showed that HLA-I polyreactive mAb TFL-006 bound to OCs (β2m-free αHLA HC) but not to CCs (β2m-associated HLA heavy chains or intact HLA molecules). TFL-006 bound only with LABScreen SABs (contained both open and CCs) but not with LIFECODES, which had only CCs, as established in previous reports [45,47].
TFL-006 (20 ug/mL)
HLA-ANCPCA*01:01A*02:01A*02:03A*03:01A*11:01A*11:02A*23:01A*24:02A*24:03A*25:01A*26:01A*29:01A*29:02A*30:01A*31:01A*32:01A*33:01A*33:03A*34:02A*36:01A*43:01A*66:01A*66:02A*68:01A*68:02A*69:01A*74:01A*80:01
REGULAR LABSCreen BEADSET (Lot: LS1A04-lot 10) [Closed Conformers admixed with Open Conformers]
012933339101819347825371337162516194222110177781496396515103855415351353247918861454713118531286523132
LIFECODES BEADSET (Lot # 3005619) (Closed Conformers only)
000000000000000000000000000000
HLA-BB*07:02B*08:01B*13:02B*14:01B*14:02B*15:01B*15:02B*15:03B*15:12B*15:13B*15:16B*18:01B*27:05B*27:08B*35:01B*37:01B*38:01B*39:01B*40:01B*40:02B*41:01B*42:01B*44:02B*44:03B*45:01B*46:01B*47:01B*48:01B*49:01B*50:01B*51:01B*52:01B*53:01B*54:01B*55:01B*56:01B*57:01B*58:01B*59:01B*67:01B*73:01B*78:01B*81:01
REGULAR LABSCreen BEADSET (Lot: LS1A04-lot 10) [Closed Conformers admixed with Open Conformers]
862122625147805183133519351822770313530763096634165961282650252170434292697373934736501829173635722152326215541799246121465442166225193662208952683553406142329961525
LIFECODES BEADSET (Lot # 3005619) (Closed Conformers only)
001203000000000000000000000010008020000010200
HLA-CC*01:02C*02:02C*03:03C*03:04C*04:01C*05:01C*06:02C*07:02C*08:01C*14:02C*15:02C*16:01C*17:01
REGULAR LABSCreen BEADSET (Lot: LS1A04-lot 10) [Closted Conformers admixed with Open Conformers]
4066744624584504333791245644870260903937446546488296
LIFECODES BEADSET (Lot # 3005619) (Closed Conformers only)
12000824497104010
Table 6. HLA-I reactivity of different therapeutic preparations of IVIg.
Table 6. HLA-I reactivity of different therapeutic preparations of IVIg.
Therapeutic Preparations of IVIgReactivity of Different HLA Class I Antigens
Classical HLA-Ia AllelesNon-Classical HLA-Ib
ABCwEFG
IVIg (GamaSTAN, Talecris Biotherapeutics, Inc., Research Triangle Park, NC, USA)315016PositivePositivePositive
IVIg (Octogam, Octapharma S.A. Argentina Poniente, Mexico, D.F.)304716PositivePositivePositive
IVIg (Sandoglobulin, CSL Behring, Kankakee, IL, USA)304716PositivePositivePositive
IVIg (GlobEx, Bangalore, India)203916PositivePositivePositive
IVIg (IV-LFB-CNTs LFB Biomedicaments, Courtaboeuf Cedex, France)315016PositivePositivePositive
Table 7. Comparison of natural and functional characteristics of IVIg and HLA-I polyreactive mAbs.
Table 7. Comparison of natural and functional characteristics of IVIg and HLA-I polyreactive mAbs.
Source, Nature, and FunctionsIntravenous Immunoglobulin (IVIg)HLA-I Polyreactive mAbs, TFL-006 & TFL-007
ManufacturerSeveral pharmaceutical firmsTerasaki Foundation Laboratory, U.S. Patent No. 10,800.847;10/13/20
SourcePurified from pooled plasma of 10,000 blood donorsImmunized in mice with a heavy chain of HLA-ER107
Nature of antibodyHuman, polyclonal IgG with trace levels of IgA Murine purified monoclonal IgG
Subclass of IgG antibodiesIgG1, IgG2a, IgG3, IgG4IgG2a
PurityContains soluble HLA antigens and other non-IgG proteins100% purified protein of IgG2a [44,45]
Cytokines, chemokines
Antibody reactivity CCs & OCs of HLA-A, HLA-B, HLA-Cw, HLA-E, HLA-F OCs but not CCs of HLA-A, HLA-B, HLA-Cw, HLA-E, HLA-F, HLA-G
HLA-G, HLA-DR, HLA-DQA/DQB, HLA-DPA/DPBNone
Fc receptors: FcgI, FcgII, FcgIII, FcgIV (tested) [96]FcgII (anticipated)
Blood groups: A, B, Rh No
Escherichia coli bacterial antigens ranging from No
antigens by different preparations of IVIgNo
Human albumin No
PhospholipidsNo
Binding siteBinds to both closed and open conformersBinds only to open conformers
StabilizerMany, including sucrose in some preparationsNone
Protein concentrationHighly variable, from 2 to 12%Protein concentration adjusted to requirement
CD4+ T-cell suppressionPHA- or cytokine-activated T cells by apoptosis and necrosisPHA-activated T cells
CD8+ T-cell proliferation PHA-activated T-cellsPHA-activated T cells
B-cell proliferationMay induce differentiationNone
Anti-HLA antibody suppressionPRA antibody reduction Suppress production of anti-HLA-I and anti-HLA-II IgG
Suppress selected HLA-II antibody production
Promote selected HLA-II antibody production
Expansion of TregsYes Yes
Special application Not applicableTo monitor the presence of open conformers admixed with
closed conformers on the bead sets. (e.g., LABScreen vs
LIFECODE bead sets used in monitoring HLA antibodies
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Ravindranath, M.H.; Hilali, F.E.; Filippone, E.J. Therapeutic Potential of HLA-I Polyreactive mAbs Mimicking the HLA-I Polyreactivity and Immunoregulatory Functions of IVIg. Vaccines 2021, 9, 680. https://doi.org/10.3390/vaccines9060680

AMA Style

Ravindranath MH, Hilali FE, Filippone EJ. Therapeutic Potential of HLA-I Polyreactive mAbs Mimicking the HLA-I Polyreactivity and Immunoregulatory Functions of IVIg. Vaccines. 2021; 9(6):680. https://doi.org/10.3390/vaccines9060680

Chicago/Turabian Style

Ravindranath, Mepur H., Fatiha El Hilali, and Edward J. Filippone. 2021. "Therapeutic Potential of HLA-I Polyreactive mAbs Mimicking the HLA-I Polyreactivity and Immunoregulatory Functions of IVIg" Vaccines 9, no. 6: 680. https://doi.org/10.3390/vaccines9060680

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop